KEGG   Providencia stuartii BE2467: BGK56_09130
Entry
BGK56_09130       CDS       T04734                                 

Definition
(GenBank) integrating conjugative element membrane protein
Organism
psta  Providencia stuartii BE2467
SSDB
Motif
Pfam: DUF4400 DinB_2
Other DBs
NCBI-ProteinID: APG51092
LinkDB
Position
complement(1967572..1968321)
AA seq 249 aa
MATAEVRQETPRHPAKDPGLPAKLLWHWPWAIIGVLLASWVCSLLIEWVGIAFFWADEGA
EHSRQVMLTESGYLSEGFTRSLLMSSPAQWLAHTVEQAYRWLFVESGLMESWQNVYPVSG
NAVARELDDWRIWFVSELRDYLLATVYVTLTFFIRVTILVLSMPLFVMVLLVGMVEGFNR
RDLRRYGAGYESSFVYHHAKRFVKPAFFVPCMIYLSWPSAIYPNLVLLPAALLFGLAVAV
ATASFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcaactgctgaggtacgtcaggaaaccccgcgtcacccggcaaaagaccccggtttg
ccggctaaattgttgtggcactggccgtgggccatcatcggggtattactggcctcctgg
gtatgcagtctgttgattgagtgggtcgggattgcgtttttctgggcggacgaaggggcg
gagcacagccggcaggtgatgttaaccgagagcgggtatctgtcagaagggtttacccgt
agtctgctgatgtccagtccggcgcagtggctggctcataccgttgaacaggcataccgg
tggctgtttgtggagtccgggctgatggagagctggcagaacgtgtatcctgtcagcggg
aatgcagttgcccgtgaactggatgactggcggatttggtttgtgtccgagctgagagac
tatctgctggcgacggtttatgtgacgctgaccttttttatccgggtgactattctggtg
ctgtcgatgcccctgtttgttatggtgctgttggtgggcatggtggaaggctttaaccgg
cgtgatttgcggcgttatggtgccgggtatgaatccagttttgtgtatcaccacgccaag
cgttttgttaagccggccttttttgttccgtgcatgatttatctgtcctggccgtctgcc
atttaccctaatctggtgttgttaccggcggctctgttgttcgggcttgcggtggcagtg
gctaccgcgtcatttaaaaaatatttatag

DBGET integrated database retrieval system