KEGG   Providencia stuartii BE2467: BGK56_12295Help
Entry
BGK56_12295       CDS       T04734                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00564  Glycerophospholipid metabolism
psta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BGK56_12295
Enzymes [BR:psta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BGK56_12295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: APG51685
UniProt: A0A379GTU9
LinkDB All DBs
Position
2710603..2712111
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLKFGQNSVLKPELNKGFEYSDCWVDDARLVVLNAQEVVRKNGEVRTRTKVTRAYREDG
LWVVEAEDLRTGEKETWKAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPRAH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVRIDDNEVNYLLKVYNDHF
KKQLSKADIVWDYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEAAVGKLAPYYPNAGAAWTKNGVLPGGDIEGCDRDGYARLLRQRYNWLPEGLALRFAR
TYGSQSKLILEGANSLSDLGEAFGHNVYEAELRYLVEHEWVTELDDAIWRRTKLGMWLNE
SEKQRIAQWLAEHVNVAQPATV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtaatcggcggcggtataaacggcgctggtatcgcggca
gatgccgctggccgtggattatctgtattgctgcttgaagctcaagacttagcaagtgcg
acatcatctgcgagttcaaaactgatccacggtggtttacgttatcttgagcattatgaa
tttcgccttgtgagtgaagcacttgctgaacgcgaggtgttattaaaacttgcgccacac
attgcgtttccaatgcgcttccgtctgccgcaccaacctcacttacgcccagcttggatg
atccgtattggcttgttcctgtatgatcacttgggtaaacgtaccagcttgcccggcagt
aaagggttaaaatttggtcaaaattccgtccttaagcctgaacttaacaaaggtttcgaa
tattcagactgttgggtcgatgatgcgcgtttggttgtattaaacgctcaagaagtggta
cgtaaaaatggtgaggttcgcacacgtacaaaagtcactcgagcctatcgtgaagatggc
ttatgggtagttgaagcagaagacctgcgcactggtgaaaaagaaacttggaaggcgaaa
ggtttagttaacgctactggcccatgggtaaaagagttctttgacgatggtttgaaactc
aaatcaccttatggcattcgtcttatcaaaggtagccatattgttgtgcctcgcgctcat
gatgagccacaagcttatattttacaaaatgaagacaaccgtattgtgtttgtgatccct
tggatggatgaattttccattatcggcaccaccgatgtcgaatacaaaggcgatccaaaa
aatgttcgtattgatgacaatgaagtgaactacttactaaaagtctataacgatcatttc
aaaaaacagttgagcaaagcggatattgtttgggattactcaggggttcgtccattatgt
gacgatgagtctgattcaccacaagccattacacgtgactacacactcgatattcacgat
gaaaatggcaaagcaccgctgctgtctgttttcggcggtaaattaaccacttatcgtaaa
ctcgcagaagcggctgtcggtaaacttgcgccttactacccaaatgcaggtgcagcatgg
actaaaaatggtgtgctgcctggcggtgacattgaaggttgtgatcgtgatggttatgca
cgcttactacgtcaacgttacaattggctaccagaaggccttgctctacgttttgcaaga
acatacggcagtcaaagcaagttgatcctcgaaggtgctaactcactcagcgatcttggt
gaagcattcggtcataacgtctatgaagcagagctacgttacttagtcgaacatgagtgg
gttactgaattagatgacgctatctggcgtcgtaccaaattgggcatgtggctgaacgaa
agtgaaaaacagcgcatcgcacaatggttggcagagcatgtgaacgtcgctcaaccagcc
acagtttag

DBGET integrated database retrieval system