KEGG   Providencia stuartii BE2467: BGK56_12615Help
Entry
BGK56_12615       CDS       T04734                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00500  Starch and sucrose metabolism
psta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BGK56_12615
Enzymes [BR:psta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BGK56_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans
Motif
Other DBs
NCBI-ProteinID: APG51746
LinkDB All DBs
Position
complement(2784531..2786840)
Genome map
AA seq 769 aa AA seqDB search
MIAQQAPGAPGSTATWTSSAKDMVGTAIGQGRVWFTVGYGILNEVYWPSCSTPQIRDLGF
IIAGDDFWSEVKRVHQYSITTPSSSLPLPKIVHQHERYRLELEIITDPARDVLLIHYHLE
GEGLRLYPLLAPHLGGDGDNNYGSVTSQGLAAQKNGQYLILSAENGFARGSVGYVGSSDG
WQDFSQNGGMSWEYQQAGPGNIAMIGELNHNSGVLALAFSASAQGAATLANSALAEGYQE
ARRQYAYLWAAWNETVNFPGLDKLPKTLSDAVRTSVVVLKTHEGRTFPGSLVASLSTPWG
DTHKDPGGYHLVWPRDSVEVGFAMLACGLITEVRALLAYLIAIQQPDGHWMQNNFTDGRP
YWQGIQLDEVALPVLFAAKLHEQGLLGETQGAAIRMARKALAFIAQYGPASPQDRWEENS
GINPFTLSVSIAALVAGAKAGFLEDGDKQYALDLADDWNERLESWVYVANTELDKELGIS
GHYIRLNPNCHSARFGEVMLRNRNNETINTRALLGMEYLYLVRLGLRKASDKRIEETTKL
VDEQLCVNLPAGPYYYRYNEDGYGEHEDGRAFDGSGVGRLWPLLSGERGHYAAARKEDIK
PYLNAILASASTGGMLPEQIWDKESIPERGLLTGRPSGSAMPLIWAHAELIKLIYVQKTG
VPIEQLKSVSERYGNKPPAPRARHWRDNLSCGAIPANRQLWIEAQEPFVLHYGYDNWQDI
KEQSSQPLGLGLYGVALDVSALAGKTLQFTRRFDAKGWEGRDWQVEIEV
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacagcaagccccgggcgccccgggaagcactgcgacgtggacaagtagtgca
aaagacatggtgggaacggcaatcggtcaaggacgagtatggtttaccgtaggttatggc
atcttaaatgaggtgtattggccttcttgcagtacaccacaaattcgtgatttaggtttt
attattgctggggatgacttttggtcagaggtaaagcgtgtccaccaatacagtatcact
acgccgtcatcctccttaccactgccaaaaatcgtgcatcaacatgagcgttatcgcctt
gaattagagattatcactgatcctgcgcgcgatgtcttgctgatccattatcatcttgaa
ggtgaagggctgcgattatatccgctattagcaccacatctcggcggcgatggtgacaat
aattatggttcggtgacgtctcaagggctagcggctcagaagaacgggcaatatctgatc
ttgtctgctgaaaatggctttgcaagaggcagtgtggggtatgttggtagctcagatggt
tggcaggattttagtcaaaacggtggtatgagttgggaataccagcaggctgggccaggt
aatatcgcgatgataggcgagttaaatcataactcaggcgtattggcgttagcattttct
gccagtgcgcaaggtgctgcaaccttagctaatagcgccctagcagagggctaccaagaa
gcaaggcgccagtatgcttatttgtgggcggcatggaatgaaacggtgaatttccctggg
ttagataagctgcctaaaacgttatcggatgctgttcgcacttcggttgtggtcttgaaa
acccatgaaggtagaacattccccggctcgctggtggcaagtttaagtacgccatgggga
gatactcataaggatccgggaggatatcaccttgtttggcctcgtgactccgttgaagtc
ggttttgccatgttggcgtgtggtttgatcactgaggttcgagctttactggcttacttg
attgctattcaacagccagatggtcattggatgcaaaacaatttcaccgatggtcggcct
tattggcaggggatccaattagatgaagtggcattgcctgttttatttgcagcgaaattg
catgaacagggcttactgggggaaacgcaaggtgcggcaatccgcatggcgcgcaaagcg
ttagcctttattgcgcaatatggcccagccagcccacaagaccgctgggaggagaattca
gggatcaacccatttacgctgtcggtttcgatagcagcattggtggctggcgccaaagcg
ggcttccttgaggatggagataagcagtatgcgcttgacttagcggatgattggaatgag
cggttagaatcatgggtgtatgtggctaacacggagttagataaagagcttggtatctct
gggcattacatccgcttgaatccaaattgccattctgcacgttttggtgaggtgatgttg
cgcaaccggaacaatgaaaccatcaatacgcgtgcgttattggggatggaatatctctat
cttgttcgcttaggtttacgtaaggcatcagataagcggattgaagagacgactaaactt
gttgatgagcaactgtgtgtcaatttacccgcggggccatattattatcgttataacgag
gatggatatggcgagcatgaggatgggcgtgcttttgatggtagtggtgtaggtcgtctt
tggccgttactcagtggggagcgagggcactatgccgccgcccgtaaagaggatattaag
ccttatttaaatgccattttggcttcagcaagtacaggtggtatgttgccggagcaaatt
tgggataaggagagtatacctgagagggggctattaacgggtaggccaagcggtagtgcg
atgccactgatttgggctcatgcggagcttatcaagttaatctatgtgcaaaagacgggt
gtgcctattgagcaactaaaatcggtgagtgagcgttatggcaataaacctccagcacca
cgcgcacgacattggcgtgataatttatcttgtggtgcgatacccgccaatcgccagtta
tggattgaagcacaagagccatttgttttgcattatggttatgacaattggcaggatatc
aaggagcagagtagccaacctctcggtttagggttatatggtgttgcgttagatgtcagc
gcattggcaggaaaaacactacaatttacgcgtaggtttgatgctaagggctgggaagga
cgtgactggcaagttgagatagaggtgtag

DBGET integrated database retrieval system