KEGG   Providencia stuartii BE2467: BGK56_13130Help
Entry
BGK56_13130       CDS       T04734                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psta  Providencia stuartii BE2467
Brite
Enzymes [BR:psta01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BGK56_13130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: APG51847
UniProt: A0A379GUA8
LinkDB All DBs
Position
complement(2901315..2901941)
Genome map
AA seq 208 aa AA seqDB search
MSYTLPALPYAYDALEPHFDKQTMEIHHTKHHQTYVNNTNTALEKLPELANLDIDDLIQQ
LDKVPADQRTFVRNNAGGHSNHSLFWKGLKLGTELSGDLKAAIERDFGSVDAFKEQFEKA
AASRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIIGLDVWEHAYYLKYQ
NRRPDYIKAFWSVVNWDEAAKRFAEKTK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagctatacattacctgctttaccttatgcttatgatgcgctggaacctcatttcgat
aagcaaacaatggaaatccatcacaccaagcatcatcaaacctacgttaacaacactaac
actgcgttagaaaaattacctgaactggctaacctagacattgatgatctgatccaacaa
ttggataaagttcctgctgatcaacgtacttttgttcgtaacaatgctggtggtcactca
aaccacagcctgttctggaaaggcctaaaattaggtactgaactaagcggtgatctgaaa
gcagctatcgagcgtgattttggtagtgttgacgctttcaaagaacaatttgagaaagca
gcagcttctcgttttggttctggctgggcatggctagttctaaaagatgacggtaagcta
gcggttgtttctacagctaaccaagacagccctctgatgggtgaagcgatttctggtact
tcaggttacccaattattggccttgatgtttgggaacacgcttattatctgaaatatcaa
aaccgtcgtcctgactacatcaaagcattctggtcagtcgttaactgggatgaagctgca
aaacgttttgcagaaaaaactaaataa

DBGET integrated database retrieval system