KEGG   Providencia stuartii BE2467: BGK56_18135Help
Entry
BGK56_18135       CDS       T04734                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00550  Peptidoglycan biosynthesis
psta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BGK56_18135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:psta01002]
    BGK56_18135
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
    BGK56_18135
Enzymes [BR:psta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BGK56_18135
Peptidases [BR:psta01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BGK56_18135
Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BGK56_18135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: APG52750
UniProt: A0A379GQQ2
LinkDB All DBs
Position
complement(3946844..3948052)
Genome map
AA seq 402 aa AA seqDB search
MKNFAPSRTLRHTLLGASLLFTMTQANANEPFPNSPVPAVPEIDAEAYILIDYNSGKVLA
EKNADQRRDPASLTKMMTSYVIGQAIKSGKIGAEDIVTVNEDAWATGNPIFKGSSLMFLK
PGDRVSVSQLTRGINLQSGNDACVAMADYVAGDQANFIQLMNGYVSKLGLQNTHFQTVHG
LDAEGQYSSARDMALLGQALIRDVPDEYAIYKEKEFTFNNIRQTNRNGLLWDKSLSVDGI
KTGHTNAAGYNLVASATEGQMRLISVVMGGKSMKGRDAESKKLLTYGFRFYETVKPLQAG
VEFASEPVWFGDENNVKLGVTEDLFLTIPRGRLKDLKASYDISTSELEAPLKKGQAVGTI
NFQLDGKTIEQRPLVVLKDVEEGGFFSRLIDYIKLLFHRWFG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgccccatcacgcacccttcgtcataccttgctaggtgcatcgctactt
ttcactatgacacaggcaaatgctaacgagccattcccaaatagccctgttccagcagta
cctgaaattgatgcagaagcctatatcttgattgattacaactcaggtaaagtgcttgct
gaaaagaatgcggatcaacgccgtgaccctgcgagtttgactaaaatgatgaccagctat
gttattggtcaagcgatcaagtcaggcaaaatcggtgcagaggatattgtcactgtcaac
gaagatgcatgggcaacaggtaacccaatatttaagggttcctcattaatgttcctgaaa
cccggcgaccgcgtgagtgtttctcaattaactcgtggaattaacttacaatcaggtaac
gatgcttgtgttgccatggcggactatgtcgcgggtgaccaagcgaatttcatccaattg
atgaatggctacgtcagcaaactgggcttacaaaatacccattttcaaaccgttcatggt
ttagatgctgaaggccaatatagctcagcacgtgacatggcattactcggacaggctctg
atacgtgatgttcccgatgaatatgctatctacaaagaaaaagagttcacttttaacaat
attcgccaaactaaccgtaatggtttgttatgggataaaagtctctcagttgatggcatt
aaaacaggccacactaatgctgcggggtataatttagttgcctccgcaacagagggccaa
atgcgccttatttccgtcgtaatgggcggtaaaagtatgaaaggccgtgatgcagaaagt
aaaaaactgctcacgtatggcttccgcttttatgaaaccgtcaagccgctacaagcgggg
gttgagtttgcctccgagcctgtttggtttggtgatgaaaataacgttaaacttggggta
acagaagatctgttcttaactatccctcgtggacgtttaaaagatcttaaagcaagctat
gatatctcaacatccgagctagaagcaccactgaaaaaagggcaagcagttggaactatt
aatttccaacttgatggtaaaaccatcgaacaacgccctctggtcgtgctgaaagatgtg
gaagaaggtggctttttcagtcgtttaattgactatattaagttactgttccatcgctgg
tttggctaa

DBGET integrated database retrieval system