KEGG   Providencia stuartii BE2467: BGK56_18150Help
Entry
BGK56_18150       CDS       T04734                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00550  Peptidoglycan biosynthesis
psta01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BGK56_18150
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BGK56_18150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
    BGK56_18150
Enzymes [BR:psta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BGK56_18150
Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BGK56_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: APG52753
UniProt: A0A379GY68
LinkDB All DBs
Position
complement(3950386..3952275)
Genome map
AA seq 629 aa AA seqDB search
MKNQRTPFRDHTAESMLFIRRALIAFGVIVLLTAVLVTNLYHIQVVRHEDYQTRSNDNRI
KLVPIAPSRGIIYDRNGRQLALNSTFYQLEIVPEKVADLQDTLDKLRDVIGLTDEDIANF
EKERKRSRRFTSIPLKTQLNEVQVARFAVNQYRFPGLEVKSYQRRSYPYGSALTHVIGYV
AKINDKDVERLDKEGKLPNYAASHDIGKLGIERYYEDVLHGKTGYEEVEVNSRGRVIRQL
HEQPPQAGRDIYLTIDLELQIYIEKLLTTSRAAVVVTDPRNGEILALVSNPSYDPNLFVN
GISNKDYQALLNNPDRPLINRTTQGLYPPASTVKPFISVAALSEKVITPSTTIFDPGWWQ
LPGSEKRYRDWKRWGHGKLNVVKSIIESADTFFYQVAYDMGIDRISDWMKKFGFGDYTGI
DLAEERAGIMPTREWKQKRYKKPWYQGDTIPVGIGQGYWTATPIQMSKALMTLINDGQVK
TPHLLYGTKLGNAMVPYEDKETAQIGDIHSGYWELAKQGMYGVANAPNGTGRRSFIGTPY
KAAAKSGTAQVFSYETYNASKLAEHLRDHKLMIAYAPYDKPTVAVAIILENGGAGPSVGD
IVRQIFDHVLLGDNKIEVNSVPTGTEEDR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaacgcaccccttttcgcgaccatacagcagaatcaatgttatttattcgc
cgagcattaattgcattcggcgtcattgtgctattaactgctgttcttgttactaatctc
tatcatatacaagttgttcgccacgaggattatcaaacaagatcgaatgataaccggata
aaactcgttcccattgcccctagccgcgggattatttatgaccgcaatggcagacaatta
gccttaaatagcaccttttaccaattagaaattgtgcctgaaaaagtggccgatctccaa
gacacgctggataaactgcgtgatgtcatcggtctaaccgatgaggatattgctaacttt
gaaaaagagcgtaaacgctcccgccgttttacctctatccccctaaaaacacagctaaac
gaagtacaagtagcgcgctttgccgttaaccaataccgtttccctgggcttgaagtaaaa
agctaccaacgtcgctcctatccttatggctcagcattaacccatgttattggttatgtt
gctaagatcaacgataaagacgtagagcgccttgataaagaaggaaaactgcctaactat
gccgccagccatgatatcggtaaattaggcatcgagcgctactatgaagatgtgttgcat
gggaaaacaggctatgaagaggttgaagtgaatagccgcgggcgtgttatccgccagcta
catgagcaaccgccgcaagcaggccgagatatctacttaactatcgatcttgaactgcaa
atttatattgaaaaactgctgacaacgagtcgtgccgcggtggttgtcactgacccgcgc
aatggtgaaatattggcattggtctctaacccaagctatgacccgaacttatttgttaac
ggtatatcaaacaaagactatcaagcactcttaaacaaccctgataggccgttaattaac
cgaacaactcaaggcctttatcctcccgcttcaaccgtaaaaccttttatttcggttgcg
gcgttaagcgaaaaggtgatcaccccttcaacgactatctttgacccaggttggtggcag
cttccaggctctgaaaaacgctatcgtgactggaagcgttgggggcatggcaaattaaat
gtggtgaagtcaatcattgagtctgcggatacgttcttctatcaagtcgcctatgatatg
gggattgatagaatatccgattggatgaagaaatttggctttggcgattatactggtatc
gaccttgccgaagagcgagcaggtattatgccgactcgagagtggaagcaaaaacgctat
aaaaaaccttggtatcaaggggatactatacctgtcggcattggacaaggctactggacc
gcaacgccaattcaaatgtcaaaagccttgatgacactcatcaatgacggtcaagtgaaa
acccctcatttattgtatggcaccaagctcggcaatgcgatggtgccttacgaagataaa
gagacggctcagattggtgatatccattcaggttattgggagctcgcgaagcaaggaatg
tacggtgtcgccaatgcaccaaacggtacaggaagacgtagttttatcggcacgccatat
aaggcagcagcgaaatcaggaactgctcaggtgtttagttacgaaacctataacgccagc
aagttagccgagcatttacgcgatcataaactaatgattgcctatgccccctacgataaa
ccaaccgttgcggtcgccattattttagaaaatggtggcgctggcccttctgttggcgat
atcgttaggcaaatatttgaccatgttttattaggtgataataaaatagaggttaatagc
gtaccaacaggcactgaggaagaccgttaa

DBGET integrated database retrieval system