KEGG   Paenibacillus stellifer: PSTEL_06505Help
Entry
PSTEL_06505       CDS       T03335                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pste  Paenibacillus stellifer
Pathway
pste00473  D-Alanine metabolism
pste01100  Metabolic pathways
pste01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSTEL_06505
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PSTEL_06505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pste01011]
    PSTEL_06505
Enzymes [BR:pste01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PSTEL_06505
Peptidoglycan biosynthesis and degradation proteins [BR:pste01011]
 Precursor biosynthesis
  Racemase
   PSTEL_06505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PAAR_motif Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AIQ62804
UniProt: A0A089N287
LinkDB All DBs
Position
1361284..1362486
Genome map
AA seq 400 aa AA seqDB search
MQESYRPTAAEIDLDALRANYESFRRHLPADVKLMVCVKGNAYGHGAVDVTRELETLGVD
YVSVAFLDEAIQLRQAGIALPILVLGYTPPEAIPAAWEYDVTITLFTPEVLEAVAKLPDG
DSRKLKVHIKIDSGMGRLGLLPAQAPNFIKQVCQVRQADVEGMFTHFARADEADKGYTLE
QYRRFMSVTEALRENKIHIPIIHTGNSATAIDTPELSPNMLRVGVSIYGFYPSTAVNRQE
VKLQPVMTLKTQVVYVKSLPEGWGISYGTHYRTDSGEYIATLPIGYADGYSRLLSGKAEV
LIRGRRVPVVGTICMDQCMVSLKSFADEAEQIKAGEEVVLIGRQAGVSVSADELASLMGT
IHYELVCMLANRVPRIYIRQGSAPKLVNALTQNLESNPVA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaaagctatcggccgactgcggccgagattgatttggatgcgttgcgtgccaat
tacgagagctttcgacggcatttgccggcggatgtgaagctgatggtatgcgtcaaggga
aatgcttacggccatggagcggttgacgtgacaagagagcttgagactctgggcgtggat
tatgtcagcgtggcttttctggatgaggcgattcaactgcgccaggcggggattgcactc
ccgattctggtgcttggctatacgccccccgaagccattccggctgcctgggagtacgat
gttaccataacgctctttactccggaggttctggaggccgtggccaagctgcctgatggc
gacagccggaagctcaaagtgcatatcaagatcgacagcggaatgggccgcctgggactt
ctgccggcacaggcgccgaatttcatcaagcaagtatgccaagtccgacaggcagatgtt
gaaggaatgttcacgcattttgccagagcggacgaggccgacaaaggctatacactggag
cagtaccgacgatttatgagcgtgacggaagcgcttcgggagaataagatccatatccca
atcatacatacgggcaacagcgctacggccatcgataccccagagctgtctccgaacatg
ctccgtgtgggcgtaagcatttacggcttttatccgtcgaccgcggtcaaccggcaggag
gttaagctgcagccggtcatgacgctgaagacacaggtcgtctatgtgaaaagcttgccg
gaaggctggggaatcagctatgggacccactaccgaactgatagcggggagtatatcgcg
acgctgccgatcgggtatgcggacgggtattcccggctgctgagcggcaaggcggaagtg
ctaatacgcggccgtcgcgttcctgtcgtcggaaccatctgcatggaccagtgtatggta
tcgctcaaatctttcgccgacgaggcggaacaaatcaaagccggcgaagaggttgtcctc
atcggccgtcaggctggagtctccgtttcggcggacgagctggcctcccttatgggaacc
attcactatgagttggtgtgcatgctggcgaaccgggtcccacggatctatatccggcaa
ggctcggctccgaaattggtcaatgcgctcacccaaaacctggagtccaatccggtggca
taa

DBGET integrated database retrieval system