KEGG   Paenibacillus stellifer: PSTEL_09160Help
Entry
PSTEL_09160       CDS       T03335                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pste  Paenibacillus stellifer
Pathway
pste00330  Arginine and proline metabolism
pste01100  Metabolic pathways
pste01110  Biosynthesis of secondary metabolites
pste01130  Biosynthesis of antibiotics
pste01230  Biosynthesis of amino acids
Module
pste_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PSTEL_09160
Enzymes [BR:pste01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PSTEL_09160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored GFO_IDH_MocA Shikimate_DH Lactate_perm NAD_binding_2 Sacchrp_dh_NADP ApbA SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AIQ63235
UniProt: A0A089LT06
LinkDB All DBs
Position
1958035..1958838
Genome map
AA seq 267 aa AA seqDB search
MEERIHFIGGGQMAEAIIRAIVSNQTISADRISVTDINEARLQFLDKTYGVNTDSSQEKF
LAEADLIVIAVRPQDNLAALGQAVQKSAASAAAIVSIVAGVTIEKLAGFFGAERPIARVI
PNTLTDTGYGYSGVALNANANREQVDGFLGGFGKVQYLDEALIDIFTGFGVAGPNYIYYF
IESLADAGVLAGLPRELAWNVALENCVGAVAMLKHTGLHPRQLLDINNSPGGVGINGLYE
LNNSDFAAGLQRSVLAAVKRTTELGAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atcgaggaacggattcactttattggcggcggacaaatggccgaggccatcatccgcgct
attgtatccaatcagacgatatctgcggatcgaattagcgtaacggatatcaatgaggcg
cgccttcagtttcttgacaagacttatggagtgaatacggacagctcccaggagaaattt
ctggctgaggcagacttgattgtgattgcggtccggccgcaggacaatctggctgcattg
ggacaagctgtacagaaatccgctgcatccgccgccgcaatcgtgtcgattgtggcgggt
gtaacgatcgagaagctggccggcttctttggagctgagcgtccaattgcccgggtcatt
cccaatacgttgaccgacacgggttacggctacagcggggtagcgctgaatgcgaacgcc
aatcgggagcaggtagacggcttcctaggcggattcggcaaagttcaatatctggacgag
gccttgattgacatcttcaccggatttggcgtggctggaccgaattacatctattacttc
attgagtcacttgcggatgccggtgtgctcgccggattgccgcgggaactggcgtggaac
gttgcattggaaaactgcgttggagctgttgccatgctgaagcacaccggactacatcca
agacaactgcttgatatcaacaactcacccggcggtgtaggcattaacggcctgtatgaa
ctgaacaacagcgatttcgctgccggcctgcagagaagtgttctggcagccgttaagcgg
acaacggagttaggggcgaaataa

DBGET integrated database retrieval system