KEGG   Paenibacillus stellifer: PSTEL_10050Help
Entry
PSTEL_10050       CDS       T03335                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pste  Paenibacillus stellifer
Pathway
pste00020  Citrate cycle (TCA cycle)
pste00480  Glutathione metabolism
pste01100  Metabolic pathways
pste01110  Biosynthesis of secondary metabolites
pste01120  Microbial metabolism in diverse environments
pste01130  Biosynthesis of antibiotics
pste01200  Carbon metabolism
pste01210  2-Oxocarboxylic acid metabolism
pste01230  Biosynthesis of amino acids
Module
pste_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pste_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTEL_10050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSTEL_10050
Enzymes [BR:pste01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSTEL_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ63379
UniProt: A0A089N3W7
LinkDB All DBs
Position
2138464..2139759
Genome map
AA seq 431 aa AA seqDB search
MLKLEKFELPTEGEQITIEGGKLLVPDHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYG
GKKSIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKHPELVDMVIFRENTEDIYAGIEYQEGSEQVKKVIEFLQ
NEMGVSKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAVKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDKVFTWNQYDKIKDAEGTDAANAAQKAAEQEGKVIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVVLSGVMMLEHLGWQEAADLIYKGMGTAINNKTVTYDFARLMEGATELKC
SEFADEVIKHM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctggaaaaattcgaactgccaacggaaggcgagcaaattaccattgaagga
ggcaaactcctggttccggatcatccggtcattccattcattgaaggcgacggaacgggc
cgggatatctggaaggcgtccaagcgcgtactcgacgctgcggtagagaaagcttacggc
ggcaagaagagcattgcctggtacgaagtgttcgccggagagaaggcgttcaatacatat
ggagaatggctgcctaacgatacgctcgaagcaatccgcgaatatatcgtggcgatcaag
ggaccgctcacgactccgatcggcggaggcatccgttccctgaatgtggcccttcgtcag
gagctggatctgtatgtctgcctgcgtcccgtccgttatttcgacggcgtgccttctccg
gtcaagcatccggagctggtcgacatggttattttccgcgagaacacggaagatatttat
gccggtatcgaataccaggaaggctcggagcaggttaagaaggtcatcgaatttttgcaa
aatgaaatgggtgtaagcaagatccgcttccctgagacgtcgggcatcggcatcaagccg
gtatcctcggaaggctccaagcgtctcgtccgggcagctgtcgaatatgcggtcaagcat
ggccgcaagagcgttacgcttgtgcataaaggcaatatcatgaagttcacggaaggcgcg
ttcaagaactggggctatgaagtggccgagcaggaattcggcgacaaggtgttcacatgg
aaccagtacgacaagatcaaggatgccgaaggtaccgacgcggctaatgcggcccagaaa
gcagccgagcaggaaggcaaagtcatcatcaaggacgccattgcggatatcgcactgcag
caggtgctgacgcggccgacggatttcgacgtcattgctacgctgaacctgaacggcgac
tacctgtccgatgcgctggcagcgcaaatcggcggaatcggcatcgcgcctggcgcgaac
atcaactatgtgactggacatgccatttttgaagcgactcatggcaccgctccgaaatat
gccgacaaggatgtcgtgaacccgggttcggtcgtgctgtccggcgttatgatgctggag
catctgggctggcaggaagccgccgatctgatctacaaaggcatgggaacggcgatcaac
aacaagacagttacctatgattttgcacgtttgatggaaggcgcaaccgagctcaagtgt
tcggaattcgctgacgaagtcatcaagcatatgtag

DBGET integrated database retrieval system