KEGG   Paenibacillus stellifer: PSTEL_17665Help
Entry
PSTEL_17665       CDS       T03335                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
pste  Paenibacillus stellifer
Pathway
pste00260  Glycine, serine and threonine metabolism
pste00270  Cysteine and methionine metabolism
pste00680  Methane metabolism
pste01100  Metabolic pathways
pste01120  Microbial metabolism in diverse environments
pste01130  Biosynthesis of antibiotics
pste01200  Carbon metabolism
pste01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PSTEL_17665
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTEL_17665
   00270 Cysteine and methionine metabolism
    PSTEL_17665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pste04147]
    PSTEL_17665
Enzymes [BR:pste01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     PSTEL_17665
    1.1.1.399  2-oxoglutarate reductase
     PSTEL_17665
Exosome [BR:pste04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTEL_17665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 IlvN ACT_4 F420_oxidored UDPG_MGDP_dh_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AIQ64661
UniProt: A0A089LSZ0
LinkDB All DBs
Position
3657679..3659271
Genome map
AA seq 530 aa AA seqDB search
MFKILVSDPISDLGIQQLTDASDVTVDKKTGLSEDELVAIIGEYDGLLVRSQTTVTPKII
EAGAKLKVIGRAGVGVDNINLEAATKRGIVVINAPDGNTITTCEHAFAMMMALARHIPQA
YAKTITGVWDKKSYLGVELRNKTLGVLGMGRIGSEVAKRAKAFGMNILAYDPFLTEDRAE
KLEVKIATVDDIVRNADFITVHTPLTPQTKHMISRPQFEVMKKGMRIVNCARGGVIDEMA
LVEALDAGIVAGAAFDVFEKEPPQADHPFLSNPKIIVTPHLGASTVEAQENVAIDVSEQV
LHILRSEPFINAVNIPPVAPSVMNKLQPYFTLGEKLGSFAAQITHGAIKEIVVEFAGDLA
DVDTQPLNRYIVKGVLSRHFGGDVNIINSMHLAKTSEVNVVVTKASKTKGFTNLISVKLI
ADGGEERVVAGTLLQGYGERIVQLGKFPVDISPEGHQILISHNDKPGIIGNVGTLLGQSD
VNIASMQVGRIVVGGEAIMLLTVDKEVPAEVLVKLAALAEINTATEVVLV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaattttggtatcggacccgatcagcgatctcgggattcagcagctgacggac
gcaagcgatgtaacggttgacaagaagacaggactcagcgaggatgagctcgtcgccatt
atcggcgaatatgatggcctccttgttcgttcccagactaccgtcactcccaaaatcatc
gaagccggagccaagttgaaggtcatcggccgtgcaggcgtgggcgttgacaatattaat
cttgaagctgcaaccaagcgcggtatcgttgttatcaatgccccggacggcaacaccatt
actacgtgtgaacatgctttcgccatgatgatggctcttgcccgccatatcccgcaagcg
tatgccaagaccattacaggcgtatgggacaagaaatcgtacctcggcgttgagcttcgc
aacaaaactctcggcgttctcggaatgggccgaatcggaagcgaagttgccaaacgcgcc
aaagcgttcggcatgaatattctggcctacgatccattcctgaccgaagatcgtgcagaa
aagcttgaagtgaaaatcgctacagtggatgacattgtaagaaacgccgactttattacg
gtgcatacgccgctgactccgcagacgaagcatatgatctcccgtccgcagttcgaggtc
atgaagaagggtatgcgcatcgtgaactgtgcacgcggtggagtcatcgacgaaatggct
ctggtggaagcccttgatgccggcatcgtggcaggcgcagcattcgacgtattcgagaag
gagccgccgcaagctgaccatccgttcctgtccaatccgaaaattatcgtgactccgcac
cttggtgcttcgacggtggaagcccaggagaacgtggcgatcgacgtatccgagcaggtg
ctccatatcctgcggagcgaaccgtttatcaacgcggtcaacattcctccggttgctcct
agcgttatgaacaagcttcagccgtacttcacgctcggcgagaagctgggcagcttcgcc
gctcaaattacacacggagccattaaggagatcgttgtggaattcgcaggcgatctggct
gatgtcgatacccagcctcttaaccggtacatcgtaaagggcgtactctcccgtcatttc
ggaggagacgtgaacatcatcaactccatgcacctggccaagacaagcgaagttaacgtc
gtggtcaccaaggcttccaagacgaagggcttcaccaacctgatctccgtgaagctgatc
gccgacggcggcgaagagcgtgtcgttgcaggaacgctgcttcagggctatggcgagcgc
attgttcagctcggcaagttcccggtagatatctcgccagaaggacatcaaattctgatt
tcccataatgacaaaccgggcatcatcggtaatgtcggcaccctgctcggccagagcgat
gtgaacatcgcctccatgcaggtcggacgtatcgttgtcggtggggaagctatcatgctg
ctgactgtagacaaagaagtgccggctgaggtgcttgtgaagctcgccgctcttgcggaa
attaacaccgcgaccgaagtggtgctggtttaa

DBGET integrated database retrieval system