KEGG   Paenibacillus stellifer: PSTEL_22965Help
Entry
PSTEL_22965       CDS       T03335                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pste  Paenibacillus stellifer
Pathway
pste00970  Aminoacyl-tRNA biosynthesis
pste01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pste00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSTEL_22965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pste03029]
    PSTEL_22965
Enzymes [BR:pste01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSTEL_22965
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSTEL_22965
Mitochondrial biogenesis [BR:pste03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSTEL_22965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIQ65537
UniProt: A0A089LXA5
LinkDB All DBs
Position
complement(4783460..4784899)
Genome map
AA seq 479 aa AA seqDB search
MPSSKYETVIGLEVHVELHTQSKIFCGCSTEFGAPPNTHTCPVCLGHPGVLPVLNRQAVD
YAMKAAMALNCTIGNVSKFDRKNYFYPDSPKAYQISQFDQPIGLNGWLDIEVDGETKRIG
ITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLLEIVSEPDLRSPEEARAYLEKIRAIMQ
YCDVSDVKMEEGSMRCDANISLRPIGQQEFGTRAELKNMNSFRGVLRGLEYEEFRQAEIL
DEGGEVVQETRRWDDAKEKTFAMRGKEEAHDYRYFPDPDLIVLHIDEAWKESIRASIPEL
PDARRARYAEEYGLPAYDAGVITSSKALADFFEGSLKFTDDAKSVSNWIMGDLLAYLNSN
NLELSEVKITPQGLGEMIGLIDKGTISSKIAKTVFKEMLESGKLPAQIVEEKGLVQISDE
GAIKGIVEAVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLVNKLLAEVLNG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccatcatccaagtacgaaaccgtcatcggtcttgaagttcacgtcgagcttcatacc
caatcgaagattttctgcggttgctccacggaattcggagcgcctcccaatacccatacc
tgcccggtctgcctgggccatccaggcgtcctgccggtcttgaaccgccaggcggtggat
tatgccatgaaagcagccatggcgctgaactgcacaatcggcaacgttagcaagttcgac
cgcaagaactatttttatcccgattcgccgaaggcttaccagatctcccagtttgatcag
ccgatcggcctgaacgggtggctcgacattgaagtggacggtgagacgaagcgaatcggc
attacccgccttcatctcgaagaggatgcaggcaagctgacccatgtggacggcggctac
gcttcgcttgtcgatttcaaccgtgtcggcacgccgctgctcgaaatcgtctcggagccg
gatctccgttctcccgaagaggcgagagcatacctggagaagatccgcgcgatcatgcag
tactgcgacgtctctgacgtcaagatggaagagggctcgatgcgctgcgacgcgaacatc
agcctgcggcctatcggccagcaagaattcggaacgcgcgcggagcttaagaacatgaac
tccttccgcggcgtgctgcggggactggagtatgaggagttccgccaggccgaaattctg
gacgagggcggcgaagttgtgcaggagacgcggcgttgggatgacgccaaggagaagacc
ttcgccatgcgcggcaaggaagaagcccatgattaccggtacttccccgatcccgacctg
atcgtgctgcatatcgacgaggcctggaaggaatcgatccgtgcttccattccggagctt
ccggacgctcgcagagcgcgctacgccgaggaatacggcctgcccgcctacgatgcgggt
gtcattacctcctccaaagcgctggccgatttctttgagggaagcctgaagttcactgac
gacgccaaatcggtctccaactggatcatgggcgacctgctggcttatctcaacagcaac
aatctggagctgtccgaggtcaagattaccccgcagggccttggcgagatgatcggcttg
atcgacaaagggaccatcagcagcaagatcgccaagaccgtctttaaggaaatgctcgaa
tccggcaagctgccggcccagatcgtggaagagaaggggcttgtgcagatcagcgacgag
ggagccatcaaaggaattgtggaagcggtcgttgcggccaatccgcagtcggttgaagat
tacaaggcaggcaagcagaaagcgatcggcttccttgtcggccaggtcatgaaagagagc
aaaggcaaggccaatcccggcctcgtgaacaaattgctggcagaagtgctgaacggctga

DBGET integrated database retrieval system