KEGG   Paenibacillus stellifer: PSTEL_23570
Entry
PSTEL_23570       CDS       T03335                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pste  Paenibacillus stellifer
Brite
KEGG Orthology (KO) [BR:pste00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSTEL_23570
Enzymes [BR:pste01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     PSTEL_23570
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ65644
UniProt: A0A089N9Y2
LinkDB
Position
complement(4916680..4918149)
AA seq 489 aa
MAVNNQVQLITYPDSMGGDLERLNHVLERYFADIFKGGVHILPPFPSSGDRGFAPLTYLE
IEPSFGTWEEIKAIGEKYDVLLDLMVNHISRQSAYFQDFLHQGRRSPYADLFLTLDKIWE
DGRPVPEDIAKMFLRRSLPYSTFTIKETGEEEKVWTTFGKTDPSEQIDLDIHSEMVKSLL
KEIFENFKRNKVKIVRLDAVGYVIKKLGTSCFFVEPDIYEFLDWIKELADSLEIELLPEV
HAHYSIQYKLAEHGFWIYDFILPYRILDTLVNKNSEALLDYLRTRPAKQFTMLDCHDGIP
VKPDLDDLIDTKEARKLVDICVERGANLSLILSDEHKDRDGFDVHQIRCSFYSVLNCDDD
AYLAARAIQFFTPGIPQVYYVGLLAGENDMDSVRQTGEGREINRHNFSVEEIERSLEKKA
VQRLLQLIRFRNGYGAFNGEFRVLDSAKDEVRLEWSKGNLRCTLNVNLSANRSVIEYADE
EGQNVRYEV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggtcaacaaccaagtacagctgattacgtatcccgactcgatgggcggggactta
gagcggctgaatcatgtgctggagcggtattttgcggatattttcaagggcggtgtccac
attcttcccccctttccttcgtcgggagacagagggttcgctccgctgacgtatctggag
atcgagccaagcttcggaacatgggaagagatcaaagctattggggaaaagtacgatgtt
ctgctggacctgatggtcaatcatatttcgcggcagtcggcatattttcaggattttctg
caccaaggaagacgttcgccttatgcggatctgtttctgacgctggataaaatatgggag
gacggaaggccggtaccggaggacatcgccaaaatgtttctgcggcggagcctgccgtat
tccaccttcaccatcaaggagaccggagaagaggagaaggtgtggaccaccttcggaaag
accgatccgtccgagcagatcgacctcgatattcattcagagatggtcaagagcctgctg
aaggagatcttcgagaatttcaagcgaaacaaggtcaagattgtcagactggatgccgta
ggttatgtcattaaaaaactcggtaccagctgcttcttcgtggaaccggatatttatgaa
ttcctggactggatcaaggagctggctgactcgcttgaaatcgagcttcttccggaggtt
catgcccattacagcattcaatacaagttggcggagcacggattctggatttatgacttt
attctgccctaccgcatcctcgatacgctggtgaacaagaacagtgaagcactgcttgat
tatttgcggacgcgtccggcgaagcagttcaccatgctggactgccatgacggcatcccc
gtgaagcccgatctcgatgatctcatcgatacgaaggaggcgcggaagctggtcgatatt
tgcgtggagcgcggcgccaacctcagcctcattctatccgatgagcataaagacagagac
gggttcgatgtccaccagatccgctgctcgttctactcggtcctgaactgcgacgacgac
gcctatctggcggcccgggctatccagttctttacgccgggcattccgcaggtgtattat
gtagggcttctggccggcgagaatgatatggacagcgtgcggcagacgggggaaggccgg
gaaatcaaccggcataacttcagcgtggaggagatcgagcgatcgctggagaagaaggcc
gtgcagcggctgcttcagctgatccggttccgtaacgggtatggggcctttaacggggag
ttccgggtgctggactccgccaaagatgaagtccggctcgaatggagcaaagggaatctg
cgctgcaccctgaatgtaaatctctccgccaatcggtctgtcatcgaatatgcggatgag
gaaggccagaacgtacgatacgaggtatag

DBGET integrated database retrieval system