KEGG   Paenibacillus stellifer: PSTEL_23835Help
Entry
PSTEL_23835       CDS       T03335                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pste  Paenibacillus stellifer
Pathway
pste00620  Pyruvate metabolism
pste00680  Methane metabolism
pste01100  Metabolic pathways
pste01120  Microbial metabolism in diverse environments
pste01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pste00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTEL_23835
  Energy metabolism
   00680 Methane metabolism
    PSTEL_23835
Enzymes [BR:pste01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSTEL_23835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace Enkurin
Motif
Other DBs
NCBI-ProteinID: AIQ65688
UniProt: A0A089M2F3
LinkDB All DBs
Position
complement(4985603..4988395)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTAGKVNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSVFLP
ELHSEFKELINSLDSENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRVRDFSPKEVWEIVNGLSLELVMTAHPTEAMRRAILDIHKRIADDVTGLDDPT
LTYREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFHVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTSSVTLQTLRLQRILAVREYQRIMRQ
LIQYLSFSTSIVKVTPELLESIEKDKAIIKLERGDAWRNANEPYRIKLSYMISKIQNVLD
DEKKGSLERYASPDELIQDLNIIDRSLRHHFADYVADTYIKKLVRQVELFGFHTATLDIR
QHSQEHENAMREILAKMDITPDYSKLSEDEKIELLEKLLHDPRPLTSPYQEYSESTQECL
AVYRTIHTAQTEYGQNCITSYLISMAEAASDILEVMVFAKEVGLFRMENDGSVTCTLQAV
PLFETIDDLHAAPDIMRRIFGLPVYRQAVTAMSNLQEIMLGYSDSNKDGGVVTANWELRI
AMKGLTAMADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMKGIAYRSLEQATSALVIAAINARTPHSDLYEDKWEEICREISEVSLNKYQDLIFRD
PDFLSFFKESTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFSWTQSRYLLPAWYAAG
TGLQSFYDNKEENLKILQHMYEHFSFFTSLVDTLQMAIAKADLIIAKEYAEMGKNEEARR
RIYGQIEQEFRLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLTELRA
LREQEQDDPELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgcaggcaaagtcaactccaataacctgctgcggcgagac
gtacggttcctggggaacattttgggcgaggttctggtacatcaaggcggaaatgaactg
cttgagatcgtggagaaaatccgggaaaccagtaaatcgttgcgctcagtgttcttgcct
gaactgcacagtgaatttaaggagttaatcaattccctggattcggagaacaggcaccag
gtgatacgggcttttgccatttattttcagctggtgaatatcgccgagcagaaccaccgg
attcgccgcaaaagagactacgagcgctccgcgggcgaaaccgttcagccagggtccatc
gagagcgcgattcaggaactgcgggtacgggatttctcccccaaggaagtatgggagatc
gtaaacggcctgtcgctggagctggtcatgactgctcatcctacggaagcgatgcgccgg
gcgattctggatatccataaacggattgcggatgatgtaacggggctggacgatccgact
ctgacttaccgggaacgggaacagcttcgcgagaagctgctgaacgaggttattacgctt
tggcagactgatgagctgcgcgaccgcaagccgacggtgcttgacgaagtgcggaacggg
atgtattacttccatgagacgattttccatgtgttgccggacgtctatcaagaactggag
cgatgtttaagcaaatactatccgggccagaattggcatgttccgacgtatctgcggttt
ggctcctggatcggcggcgaccgtgacggcaatccttcggtgacctcgtcggtaacgctc
cagacgctgagactgcagcgcattctggctgtacgggaataccagcgcatcatgcgccaa
ctgattcagtacctgagcttcagcaccagcatcgtgaaggtaacgccggaactgctggaa
tcgatcgagaaagacaaggcgatcatcaagctggagcgcggagacgcgtggcggaacgcc
aacgagccttaccggattaagctcagctacatgatctcgaagatacagaacgtgctggac
gacgagaagaagggttcgctagaacgttacgcatcgcctgacgagcttatccaagatttg
aacattatcgaccgcagtctgcggcatcactttgccgattatgttgcggatacctatatc
aagaaattggtccgccaggttgagttgtttgggttccataccgcaacgctcgacatccgt
cagcacagccaggaacatgagaatgcgatgagagagattttggcgaaaatggacatcacg
ccggactactccaagctttcggaggacgagaagattgagctgctggagaagctgctgcat
gatccgcgtccgctgacctccccttatcaggagtacagcgagagcacgcaggagtgcctg
gccgtctaccgtaccattcatacagcgcagacggaatacggacagaactgcattaccagc
tacctgatcagtatggctgaggccgcgagcgatattctggaggttatggtattcgccaag
gaagtcggattgttccgtatggaaaatgacggcagcgtcacctgcacgcttcaggccgtt
ccgctgttcgagacgatcgacgatcttcatgcggctccggatatcatgcgcagaatcttc
gggcttccggtctaccggcaagctgttacagccatgagcaatcttcaggagattatgctg
ggctactcggacagcaacaaggacggcggcgtggttaccgccaactgggaactgcgcatt
gccatgaagggtctgacagcgatggccgacgaattcggcatcaagctgaaattcttccat
ggccgcggcggagcgctcggaagaggcggcatgccgctgaaccgcagcattcttgcccag
ccggcttcgaccatcggtggcggaatcaagatcacggagcagggcgaggttatttcctcc
cgctactccatgaagggtattgcctaccgaagcctggagcaggccacttcggcgctcgtg
atcgcggcgatcaacgctaggacgccgcacagtgatttgtacgaggacaaatgggaagaa
atctgccgggagatttccgaggtgtcgctgaacaagtatcaggatctgatcttccgcgat
ccggatttcctgagcttcttcaaggaatccacgccgcttccggaaatcggcgagctgaat
atcggctcccgtccttcgaagcgcaagaacagcgaccgcttcgaggatctgcgggcgatt
ccgtgggtattctcctggacacagagccgctatctgctgcccgcctggtatgcagcggga
acgggactgcagagcttctatgataataaggaagagaatctcaagattcttcagcatatg
tatgagcatttctctttcttcacaagcctggttgatacgctccagatggcgattgccaag
gcggatcttatcatcgccaaggaatatgccgaaatgggcaagaatgaagaggcccgcaga
cggatttacggacagatcgaacaggaattccgtctgacctccgagctcatcctgaagatt
acagggcagcaggatattctggacaacgttccggtcatccaggagtccatccggctgcgg
aatccttatgtcgatcctcttagctatttgcaggttcagcttcttacggagcttcgggcg
ctgcgcgaacaggagcaggatgatcctgagcttctgcgcgaggtgctgctcacgatcaac
ggaattgctgcgggcctccggaataccggctga

DBGET integrated database retrieval system