KEGG   Phreatobacter stygius: E8M01_08230Help
Entry
E8M01_08230       CDS       T05955                                 

Gene name
fabB
Definition
(GenBank) beta-ketoacyl-ACP synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00061  Fatty acid biosynthesis
pstg00780  Biotin metabolism
pstg01100  Metabolic pathways
pstg01212  Fatty acid metabolism
Module
pstg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E8M01_08230 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E8M01_08230 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pstg01004]
    E8M01_08230 (fabB)
Enzymes [BR:pstg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     E8M01_08230 (fabB)
Lipid biosynthesis proteins [BR:pstg01004]
 Fatty acid synthase
  Component type
   E8M01_08230 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc Thiolase_N
Motif
Other DBs
NCBI-ProteinID: QCI64233
LinkDB All DBs
Position
complement(1807767..1808993)
Genome map
AA seq 408 aa AA seqDB search
MRRVVVTGMGIVSSIGNNSNEVLASLREARSGIALAPSFVEHGFRCQVSGAPTLDPSTIL
DRRAMRFHGGGSAWNHVAMDQAILDAGLEEAEISHERTGIVMGSGGPSTRALVDAYDKAR
ESGNSKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK
QDVVFAGGCEELDWTLSVLFDAMGAMSSKFNDRPTTASRAYDVNRDGFVIAGGAGVLVLE
EYEHAKARGAKIYGEIAGYGATSDGYDMVAPSGEGAVRCMRMALEGVKAKVDYINPHGTS
TPVGDLKEIEAIREVFGGADKSPPISATKSLTGHSLGATGVQEAVYSLLMMNNGFICESA
HIEELDPDVADMPIVRRRIDDAKLGCVLSNSFGFGGTNATIVLKHVDA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgtcgtcgtcaccggaatgggcatcgtctcgtccatcggcaacaattccaac
gaggtcctggcctcgcttcgtgaggccaggagcggcatcgcgctggcgccatccttcgtc
gagcacggtttccgctgccaggtctcgggtgcgccgacactcgatccatcgaccatcctc
gatcgtcgcgccatgcgcttccacggcggcggctcggcctggaaccacgtggccatggat
caggcgatcctggacgcgggtctcgaagaggctgagatcagccacgagcgcaccggcatc
gtgatgggctccggcggcccgtcgacccgcgctttggtggatgcctatgacaaggcccgc
gagagcggcaattccaagcgcgtcggtccgttcgcggtgccgaaggcgatgtcgtcgacg
gcttcggcgacgcttgccacctggttcaagatcaagggcgtgaactactcgatctcctcg
gcctgcgcgacctccaaccactgtatcggcaatgcctatgagctgatccagtggggcaag
caggacgtggtcttcgccggcggctgcgaggagctcgactggaccctgtcggtgctgttc
gacgcgatgggcgccatgtcgtcgaaattcaacgaccggccgaccaccgcctcgcgcgcc
tatgacgtcaatcgcgacggcttcgtcattgccggcggagccggtgtcctggtgctggaa
gaatacgagcatgccaaggcgcgtggcgccaagatctatggcgaaatcgccggctacggc
gccacctccgacggttacgacatggtcgcgccgtccggcgagggtgcggtgcgctgcatg
cgcatggcgctcgagggcgtgaaggccaaggtcgactacatcaatccgcacggcacctcg
acgccggtcggcgatctcaaggagatcgaggcgatccgcgaagtcttcggcggcgccgac
aagagcccgccgatctcggcaaccaagtcgctgaccggccattcgctgggcgcaaccggc
gtgcaggaagcggtctattcgctgctgatgatgaacaacggcttcatctgcgagagcgcc
catatcgaagagctcgatcccgatgtcgccgacatgccgatcgtgcgcaggcgcatcgac
gacgccaagctcggttgcgtgctgtccaattctttcggtttcggcggcaccaatgccacc
atcgtgctgaagcatgtcgatgcctga

DBGET integrated database retrieval system