KEGG   Phreatobacter stygius: E8M01_09470Help
Entry
E8M01_09470       CDS       T05955                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pstg01100  Metabolic pathways
pstg01110  Biosynthesis of secondary metabolites
pstg01130  Biosynthesis of antibiotics
pstg01230  Biosynthesis of amino acids
Module
pstg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    E8M01_09470
Enzymes [BR:pstg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     E8M01_09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 CoaE Mg_chelatase TsaE dNK AAA AAA_22 AAA_16 Cytidylate_kin AAA_17 AAA_28 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: QCI64441
UniProt: A0A4D7AWP5
LinkDB All DBs
Position
2083295..2083885
Genome map
AA seq 196 aa AA seqDB search
MGATTAEIDTTGLRAALGARSIVLVGLMGAGKTSIGRRLAQRLGLPFIDADQEIEKAHVM
SIPEIFEKHGEAYFRAGEVRVVARILKDGPQVLATGGGAFMNPETRANIRALGISLWLKA
DLDVLMRRVRRRSDRPLLKQADPEAVLRRLMEERYPVYAEADLAIVSREASHEEIVDEAV
NVLVDHLLAPKELNQP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgacgaccgccgagatcgacacgacaggtttgcgcgcggcgcttggcgcgcgc
tcgattgtgctcgtcggtctgatgggcgccggcaagacctcgatcggccgccggctcgcc
caacgcctcggtttgcccttcatcgatgccgaccaggagatcgagaaggcgcatgtcatg
tcgatcccggaaattttcgagaaacatggcgaagcctatttcagggccggcgaggtgcgc
gtggtcgcccgcatcctgaaggacggtccgcaggtgctggccaccggcggcggcgccttc
atgaaccccgagacccgcgccaatatccgcgcgctcggcatttcgctctggctgaaggcc
gatctcgacgtgctgatgcggcgggtccggcggcgcagcgaccggccgctcttgaagcag
gccgacccggaagccgtgctccgccggctgatggaggagcgctatccggtttatgcggag
gccgatctcgccatcgtctcgcgcgaggcctcgcatgaggagatcgtcgacgaggccgtc
aatgtgctggtcgaccatctgctggcgccgaaggagttgaaccagccgtga

DBGET integrated database retrieval system