KEGG   Phreatobacter stygius: E8M01_09645Help
Entry
E8M01_09645       CDS       T05955                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pstg  Phreatobacter stygius
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E8M01_09645
Enzymes [BR:pstg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     E8M01_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QCI64473
UniProt: A0A4D7B0C5
LinkDB All DBs
Position
complement(2118175..2119011)
Genome map
AA seq 278 aa AA seqDB search
MSGTFTAACVQMRADIDIKASLDQSLGLVREAARAGAAYVQTPEMTNILQPDRPKFFETI
KAEADDPCLPVFQAEAMTLGIWLHIGSLAIKIGEKQAANRGYLISPDGEIVVAYDKIHMF
DVNLANGQTYRESAAYAPGDRAVVADLPWARLGVTICYDLRFPQLYRSLAEAGAGIMAIP
SSFTVPTGQAHWHVLMRARAIETGAFVIAAAQGGKHACGRETYGHSLIVDPWGTILAEAD
HDEPAVILAEIDPAKVAETRGRIPSLANGRVFRLEGTP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacatttaccgcggcctgcgtgcagatgcgcgcggatatcgacatcaaggcg
agcctcgatcagtcgctcgggctcgtccgtgaagctgcgcgtgccggcgcggcctatgtc
cagacgccggaaatgaccaatatcctgcagccggaccggccgaaattcttcgagaccatc
aaggccgaggctgacgatccgtgcttgccggtgttccaggccgaggccatgacgctcggc
atctggctgcatatcggctcgctcgccatcaagatcggcgagaaacaggcggccaatcgc
ggctacctgatttcacccgacggcgagatcgtcgtggcctatgacaagatccatatgttc
gacgtcaacctggcgaacggccagacctatcgggaatcggccgcctatgcccccggcgac
cgtgccgtcgtggccgatctgccttgggccaggctcggtgtgacgatctgctacgatctg
cgcttcccgcagctctaccggtcgctggccgaggccggcgccggcatcatggcgatcccg
tcctcgttcaccgtgccgaccggccaggcccattggcacgtgctgatgcgtgcgcgcgcc
atcgagaccggcgccttcgtgatcgccgcggcccaaggcggcaagcatgcctgcggccgc
gagacctatggccacagcctgatcgtcgatccctggggcacgatcctggccgaggccgac
cacgacgaaccggcggtgatcctggccgagatcgacccggccaaggttgccgagacccgc
ggccgcattccctcgctcgccaatggccgggtgttccggctggagggcacgccatga

DBGET integrated database retrieval system