KEGG   Phreatobacter stygius: E8M01_14005Help
Entry
E8M01_14005       CDS       T05955                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00071  Fatty acid degradation
pstg00280  Valine, leucine and isoleucine degradation
pstg00281  Geraniol degradation
pstg00310  Lysine degradation
pstg00360  Phenylalanine metabolism
pstg00362  Benzoate degradation
pstg00380  Tryptophan metabolism
pstg00410  beta-Alanine metabolism
pstg00627  Aminobenzoate degradation
pstg00640  Propanoate metabolism
pstg00650  Butanoate metabolism
pstg00903  Limonene and pinene degradation
pstg00930  Caprolactam degradation
pstg01100  Metabolic pathways
pstg01110  Biosynthesis of secondary metabolites
pstg01120  Microbial metabolism in diverse environments
pstg01130  Biosynthesis of antibiotics
pstg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E8M01_14005
   00650 Butanoate metabolism
    E8M01_14005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    E8M01_14005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E8M01_14005
   00310 Lysine degradation
    E8M01_14005
   00360 Phenylalanine metabolism
    E8M01_14005
   00380 Tryptophan metabolism
    E8M01_14005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E8M01_14005
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E8M01_14005
   00281 Geraniol degradation
    E8M01_14005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    E8M01_14005
   00627 Aminobenzoate degradation
    E8M01_14005
   00930 Caprolactam degradation
    E8M01_14005
Enzymes [BR:pstg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     E8M01_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: QCI69225
UniProt: A0A4D7BEZ6
LinkDB All DBs
Position
complement(3024034..3024807)
Genome map
AA seq 257 aa AA seqDB search
MSYETIIVETRGKVGLVTLNRPKALNALNSQVIGEINAVLDGFERDPGIGAIVITGSEKA
FAAGADILEMKAKTYPESYLEDFITTWDRIGQRRKPIIAAVAGYALGGGCELAMMCDFIL
AADTAKFGQPEIKLGVMPGAGGTQRLTRFVGKSKAMEMCLTGRLMDAAEAERVGLVSRIV
PAADLVAEAMKVAAQIADLSLPAVMMTKESVNRSYETTLAEGVRFERRVFHAMFAMADQK
EGMAAFAEKRPADFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctacgagaccatcatcgtcgaaacccgcggcaaggtcggcctggtcacactcaac
cggccgaaggcgctgaacgcgttgaacagccaggtgatcggcgagatcaatgcggtgctg
gacggcttcgagagggatcccggcatcggcgccatcgtcatcaccggctcggaaaaggcc
tttgccgccggcgccgacatcctggagatgaaggccaagacctatccggaaagctatctg
gaagacttcatcaccacctgggatcgcatcggccagcggcgcaagccgatcatcgcggcg
gtggccggttatgcgctgggcggcggctgcgagctcgccatgatgtgcgatttcatcctg
gcggccgataccgccaagttcggccagcccgaaatcaagctcggcgtcatgccgggcgcc
ggcggcacgcagcgcctgacccgtttcgtcggcaagtccaaggccatggaaatgtgcctg
accggccgcctgatggacgcggccgaggccgagcgggtcggcctcgtctcgcgcatcgtt
ccggccgccgacctggtcgctgaggcgatgaaggtcgcagcccagatcgccgacctgtcg
ctgccggccgtcatgatgaccaaggaatcggtcaaccggtcctatgagacgacgctcgcc
gagggcgtgcgtttcgaacgccgggtgttccacgcgatgttcgccatggccgaccagaag
gaaggcatggcagccttcgccgagaagcggccggccgacttcaagaaccgctga

DBGET integrated database retrieval system