KEGG   Phreatobacter stygius: E8M01_19095Help
Entry
E8M01_19095       CDS       T05955                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00020  Citrate cycle (TCA cycle)
pstg00190  Oxidative phosphorylation
pstg00650  Butanoate metabolism
pstg01100  Metabolic pathways
pstg01110  Biosynthesis of secondary metabolites
pstg01120  Microbial metabolism in diverse environments
pstg01130  Biosynthesis of antibiotics
pstg01200  Carbon metabolism
Module
pstg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pstg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pstg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E8M01_19095
   00650 Butanoate metabolism
    E8M01_19095
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    E8M01_19095
Enzymes [BR:pstg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     E8M01_19095
    1.3.5.4  fumarate reductase (quinol)
     E8M01_19095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA GMC_oxred_N FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: QCI66130
UniProt: A0A4D7B718
LinkDB All DBs
Position
4062814..4064634
Genome map
AA seq 606 aa AA seqDB search
MAQAAGPAVNGRAYDITDHTYDVVIVGAGGAGLRAVVGCAQAGLKTACISKVFPTRSHTV
AAQGGISASLGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFS
RTEAGKIYQRPFGGMTTHYGKGTAQRTCAAADRTGHAILHTLYGQALRNNAEFFIEYFAI
DLMMSEDGRCLGVVALKMDDGTLHRFRGRQTIMATGGYGRAYFSATSAHTCTGDGNAMVL
RAGLPLQDMEFVQFHPTGIYGSGCLITEGSRGEGGYLTNSEGERFMERYAPSAKDLASRD
VVSRSMTMEIREGRGVGKNKDHIYLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIP
VIPTVHYNMGGIPTNYHGEVYTKKGGDPDAIVPGLMAIGEAACVSVHGANRLGSNSLIDL
VVFGRAAGLRAAETVVAGEKHQDLPKEASELALSRLDKFRNASGGTPTAQLRAKMQGIMQ
SNCAVFRTGEVLEEGQKLIHEVWQGSSDIKTTDRSLIWNSDLIETLEFDNLISQAVVTMD
SAANRQESRGAHAREDFAERNDKDWMKHTLAFADDNARSVTIDYRPVHTYTMTNDIQYIE
PKARVY
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagccgccggacccgccgtcaatggccgcgcctacgacatcaccgaccacacc
tatgacgtcgtcatcgtcggcgccggcggtgccggcctgcgcgccgtcgtcggctgcgcc
caagccggtctgaagaccgcctgcatctccaaggtgttcccgacccgctcgcacacggtg
gcggcccagggcggcatttcggcctcgctcggcaatatgggcgaggacgactggcgctgg
cacatgtacgatacggtcaagggttccgactggctgggcgaccaggacgccatcgaatat
ctcgtgcgcaatgcgccggcggcggtctatgagctcgagcattggggcgtgccgttctcg
cgcaccgaggccggcaagatctaccagcggccgttcggcggcatgaccacccattacggc
aagggcaccgcgcagcgcacctgcgccgccgccgaccgcaccggccatgccatcctgcac
acgctttacggccaggcgttgcgcaacaatgccgagttcttcatcgaatatttcgccatc
gacctgatgatgtccgaggacggccgctgcctcggcgtggtcgcgctgaagatggatgac
ggcacgctgcatcgcttccgcggccgccagaccatcatggcgaccggcggttacggccgc
gcctatttctcggcgacctcggcccatacctgcaccggcgacggcaatgccatggtgctg
cgcgccggcctgccgctgcaggacatggaattcgtccagttccatccgaccggcatctat
ggttccggctgcctgatcaccgaggggtcgcgcggcgagggcggctacctgaccaattcc
gagggcgagcgcttcatggagcgttatgcgccctccgccaaggacctggcctcacgcgac
gtcgtctcgcgttcgatgaccatggagatccgcgagggcaggggggtgggcaagaacaag
gaccacatctacctgcatctcgaccatctcgacccgaagatcctgcacgagcgcctgccg
ggcatttcggaaagcgccaagatcttcgccggcgtcgatgtgaccaaggagccgatcccg
gtcatcccgacggtccactacaacatgggcggcataccgacgaactatcacggcgaggtc
tataccaagaagggcggcgacccggatgccatcgtccccggcctgatggcgatcggcgag
gcggcctgcgtctcggtgcacggcgccaaccggctcggctccaattcgctgatcgacctc
gtggtgttcggccgggccgccggcctgcgcgccgccgagacggtggttgccggcgaaaag
caccaggatctgccgaaggaagcctccgagcttgccctgtcgcggctcgacaagttccgc
aacgcctcgggcggcacgccgaccgcccagctgcgcgccaagatgcagggcatcatgcag
tcgaactgcgcggtgttccgcaccggcgaggtgctcgaagagggccagaagctgatccac
gaggtctggcaggggtcgagcgacatcaagacgaccgatcgctcgctgatctggaattcc
gacctgatcgagaccctcgagttcgacaacctgatcagccaggccgtggtcaccatggac
tcggccgcgaaccgccaggaaagccggggcgcgcatgcccgcgaggatttcgccgagcgc
aacgacaaggactggatgaagcacaccctggctttcgccgacgacaacgccaggtcggtg
accatcgattatcggccggtccacacctatacgatgaccaacgacatccaatatatcgag
cccaaagcccgggtgtattga

DBGET integrated database retrieval system