KEGG   Plautia stali symbiont: E05_03100Help
Entry
E05_03100         CDS       T03051                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psts  Plautia stali symbiont
Pathway
psts00061  Fatty acid biosynthesis
psts00780  Biotin metabolism
psts01100  Metabolic pathways
psts01212  Fatty acid metabolism
Module
psts_M00083  Fatty acid biosynthesis, elongation
psts_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E05_03100
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E05_03100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psts01004]
    E05_03100
Enzymes [BR:psts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     E05_03100
Lipid biosynthesis proteins [BR:psts01004]
 Fatty acid synthase
  Component type
   E05_03100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: BAN95076
UniProt: U3TSX8
LinkDB All DBs
Position
282606..283061
Genome map
AA seq 151 aa AA seqDB search
MTTETHTLKIEEILELLPHRYPFLLVDRVLEFEEHKYLRAVKIVSVNEPFFQGHFPDKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgacaactgaaacgcatactctgaaaattgaagagattttagaactgctgccgcaccgc
tatccgtttttgctggttgaccgcgtgctggaatttgaagagcataaatatctgcgtgcg
gtaaagatcgtttctgttaatgaaccgtttttccagggacacttccctgataaaccgatt
ttcccaggcgttctgatcctggaagctatggcgcaggcgaccggtattctggcgtttaaa
agcgttggaaaactggaaccgggcgagctgtactatttcgccggtatcgacgaagcccgt
ttcaagcgtccggtagtgccgggcgaccagatgatcatggaagtcaccttcgagaagacc
cgccgtggcctgacgcgcttcaaaggcgtggcaaccgtagacggtaagattgtctgtgaa
gcgaccatgatgtgtgcccgtagccgggaggcataa

DBGET integrated database retrieval system