KEGG   Plautia stali symbiont: E05_03310Help
Entry
E05_03310         CDS       T03051                                 

Gene name
ahpF
Definition
(GenBank) AhpF protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psts  Plautia stali symbiont
Brite
KEGG Orthology (KO) [BR:psts00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E05_03310 (ahpF)
Enzymes [BR:psts01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E05_03310 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 Thioredoxin_3 NAD_binding_8 Thi4 AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: BAN95097
UniProt: U3TV58
LinkDB All DBs
Position
complement(304226..305371)
Genome map
AA seq 381 aa AA seqDB search
MAVLNPRIRHTAIDGGMFQNEITERNVMGVPAVYLNGKEFGQGRMSLAEIVGKVDTNADK
RAAEELNKRDAYEVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQVLDTVDIENYISV
PKTEGAKLAGSLRAHVDDYDVDVIDTQSAIKLIPAAKEGGLHAIETASGAVLKSRSIIIA
TGARWRNMGVPGEEQYRTKGVTYCPHCDGPLFKGKRTAVIGGGNSGVEAAIDLAGIVEHV
TLLEFASEMRADKVLQDKLRSLKNVDVILNAQTTEVKGDGSKVTGLTYIDRNNQTSHELA
LSGIFVQIGLLPNTNWLEGAVERNRMGEILIDAKGETSLKGVFAAGDCTTVPYKQIIIAS
GEGAKASLSAFDYLIRTKPAE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctcaacccgcgcattcgtcacaccgccattgacggcggcatgttccagaat
gagatcaccgagcgcaacgtcatgggcgtgccggcggtttacctcaacggtaaagagttc
ggtcagggtcgcatgagcctggcagaaatcgtcggtaaggtagacaccaatgcggataag
cgtgcggctgaagagctgaacaagcgtgatgcgtatgaagtgctgatcgtcggcagcggc
ccggcgggcgccgcggcggccatctactccgcgcgtaaagggattcgtaccggcctgatg
ggcgagcgctttggcggccaggtgctggacaccgttgacattgaaaactacatctccgtg
ccgaaaaccgaaggggcgaagctcgccggttccctgcgtgcccacgttgatgactatgac
gttgacgtgatcgacacccagagcgccatcaagctgattccggcagcgaaagagggcggc
ctgcacgccatcgaaaccgcttccggcgcggtgctgaaatcacgcagcatcatcattgct
accggcgcacgctggcgcaacatgggcgttccgggtgaagagcagtatcgcactaaaggt
gtgacctactgcccgcactgtgacggcccgctgtttaaaggcaaacgcacggcggtgatc
ggcggcggtaactccggcgttgaagcggccatcgatctggccggtattgtcgagcacgtc
acgctgctggagttcgccagcgaaatgcgtgctgataaagtgctgcaggataaactgcgc
agcctgaaaaacgttgatgtgatcctgaacgcgcagaccaccgaagtgaaaggcgacggc
agtaaagttaccggtctgacgtacatcgaccgcaataaccagaccagccacgaactggcg
ctgagcggtatcttcgtacagattggtctgctgcccaacaccaactggctggaaggcgca
gtagagcgcaaccgcatgggcgagatcctgattgacgccaaaggcgaaaccagcctgaaa
ggcgtatttgccgccggcgactgcaccacagtgccatacaagcagatcatcattgccagc
ggggaaggggccaaagcgtcactgagcgcgtttgattacctgatccgcaccaaaccggct
gaataa

DBGET integrated database retrieval system