KEGG   Plautia stali symbiont: E05_08470Help
Entry
E05_08470         CDS       T03051                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
psts  Plautia stali symbiont
Pathway
psts00010  Glycolysis / Gluconeogenesis
psts00260  Glycine, serine and threonine metabolism
psts00680  Methane metabolism
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01120  Microbial metabolism in diverse environments
psts01130  Biosynthesis of antibiotics
psts01200  Carbon metabolism
psts01230  Biosynthesis of amino acids
Module
psts_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psts_M00002  Glycolysis, core module involving three-carbon compounds
psts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E05_08470
  09102 Energy metabolism
   00680 Methane metabolism
    E05_08470
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E05_08470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psts04131]
    E05_08470
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psts04147]
    E05_08470
Enzymes [BR:psts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     E05_08470
Membrane trafficking [BR:psts04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    E05_08470
Exosome [BR:psts04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   E05_08470
  Exosomal proteins of melanoma cells
   E05_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAN95613
UniProt: U3TUJ2
LinkDB All DBs
Position
complement(678812..679564)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKTWRLNERHYGALQGLDKAETAAKYGDDQVKQWRRGFA
VTPPELDRNDERFPGHDPRYKSLTDAQLPTTESLALTIDRVIPFWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaagctggttctggtgcgccacggcgaaagccagtggaatcaggaaaac
cgcttcaccggatggtacgacgtggatctgtccgacaagggtcgcaccgaagccaaagca
gccggtcagctgctgaaaaaagaaggtttcgtgtttgattttgcctacacctcagtgctg
aagcgtgccatccacactctgtggaacgtgctggatgagctggatcaggcctggctgccg
gtcgagaaaacctggcgtctgaacgagcgtcactacggtgcgctgcagggtctggacaaa
gcggaaaccgccgccaaatacggcgacgatcaggtgaaacagtggcgccgtggctttgcc
gttacgccgccagagctggatcgtaacgacgagcgtttcccgggccacgacccgcgctac
aaatcactgaccgacgcgcagctgccgaccaccgaaagcctggcactgaccatcgatcgt
gttatcccattctggaacgagagcattctgccgcgcatcaagagcggtgagaaagtgatc
gttgccgcgcacggtaactcactgcgcgcgctggtgaaatacctcgataacatgagcgaa
gatgagatcctcgaactgaacatcccaaccggcgtaccgctggtgtatgagttcgacgag
aacttcaagccaatcaaacattactatctgggtgatgccgacgagatcgcggcaaaagcc
gccgccgttgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system