KEGG   Plautia stali symbiont: E05_10360Help
Entry
E05_10360         CDS       T03051                                 

Definition
(GenBank) cysteine ABC transporter permease/ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
psts  Plautia stali symbiont
Pathway
psts02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psts00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    E05_10360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psts02000]
    E05_10360
Transporters [BR:psts02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    E05_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane DUF1129
Motif
Other DBs
NCBI-ProteinID: BAN95802
UniProt: U3TX92
LinkDB All DBs
Position
complement(828319..829185)
Genome map
AA seq 288 aa AA seqDB search
MAIVTLLASIDLLTLSGWFLAASSLAGVAGLYSFNYMLPAAGVRGAAITRTAARYFERLV
SHDATFRVLQHLRVFTFSRLMALAPAQLARFRHGELLNRFVSDVDTLDHLYLRVISPLLG
AAVVIVVVTCGLALLDMRLALLLGAIMLLFWRLGARTGAHIARYQARWRLQLTHWLSGLA
ELQIYGAAALWRQRLDQEERAWQQAQQRQHRLQALAQSLLMLIAGSTVTLLLWLAASSVG
TNSTPGALIALFVFCALAAFEALAPVAGAFLPLAQVTHAAQRVLEIID
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggccattgtcacgctgctcgccagcatcgacttgctgacgctgtcaggctggtttctt
gctgcctcctcgctggctggcgtcgccggcctgtacagcttcaattacatgctgcccgca
gctggcgtgcgtggcgctgcaatcacccgcaccgccgcgcgctattttgaacggctggtc
agccacgacgccactttccgcgtgctgcagcatctgcgcgtctttaccttcagccggctg
atggcgctggcgccggcgcagctggcgcgctttcgtcacggcgaactgctgaaccgcttt
gtcagcgatgtcgataccctcgaccatctctatttacgcgttatttctccgctgctgggt
gcggcggtggtgattgtggtggtgacctgtggactggcgctactcgatatgcgactggcg
ctgctgctaggagcgatcatgttgctgttctggcggctcggcgcgcgcaccggcgcgcac
attgcccgttaccaggctcgctggcgtctgcaactgacgcactggctcagcggactggcc
gagctacagatttacggcgcggcggcgctgtggcgacagcggctggatcaggaagaacgt
gcgtggcagcaggcgcagcagcgtcaacaccggctgcaggcgctggcgcagagcctgctc
atgttgatcgccggcagtaccgttacgctgctgctgtggctggccgccagcagcgtcggc
accaatagcacaccgggtgcactgattgccctgtttgtgttttgcgcgctcgccgcgttt
gaagcgctggcaccggtggccggcgcatttctgccactggcgcaggtgacgcacgcggcg
cagcgcgtgctggagatcatcgattaa

DBGET integrated database retrieval system