KEGG   Plautia stali symbiont: E05_36770Help
Entry
E05_36770         CDS       T03051                                 

Gene name
fabF
Definition
(GenBank) FabF protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
psts  Plautia stali symbiont
Pathway
psts00061  Fatty acid biosynthesis
psts00780  Biotin metabolism
psts01100  Metabolic pathways
psts01212  Fatty acid metabolism
Module
psts_M00083  Fatty acid biosynthesis, elongation
psts_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E05_36770 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E05_36770 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psts01004]
    E05_36770 (fabF)
Enzymes [BR:psts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     E05_36770 (fabF)
Lipid biosynthesis proteins [BR:psts01004]
 Fatty acid synthase
  Component type
   E05_36770 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: BAN98443
UniProt: U3U2Q8
LinkDB All DBs
Position
complement(2924574..2925815)
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTVESTWRALLAGQSGINLIDHFDTSAYATRFAGLVKDFNCD
EYISRKDQRKMDDFIQYGIVAGIQAMADSGLVVTNENAGRIGAAIGSGIGGLGLIEDNHT
SLVNGGPRKISPFFVPSTIVNMVAGHLTIMYGLKGPSISIATACTSGVHNIGHAARIIAY
NDADVMLAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKDRDGFVLGDGAGIVV
LEEYEHAKKHGAKIYAEIVGFGMSSDACHMTSPPEDGSGAAAAMVNALRDAQLDPAQIGY
VNAHGTSTPAGDKAEAQAVKSVFGASAHSVMVSSTKSMTGHLLGAAGAVEAINSILALRD
QAVPPTINLDNPDEGCDLDFVPHTARQVSGLEYTLCNSFGFGGTNGSLIFRKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgtgtagttgtgaccggtcttggcatgttgtctcctgtcggcaatacc
gtagagtctacctggcgtgctctccttgccggtcagagcggcattaacctgatcgaccat
tttgataccagtgcctacgcaacgcgttttgcgggtctggtcaaagattttaattgcgat
gaatacatctcgcgtaaagatcaacgcaagatggatgatttcatccagtacggcattgtg
gccggtattcaggctatggcggactccggtctggtcgtaactaatgagaatgccggacgt
atcggtgcggctatcggttccggcatcggcggtctgggattgatcgaagataaccatacc
tcgctggtcaatggcggtccgcgcaaaatcagtccattcttcgtgccttcaaccatcgtt
aacatggtcgctggccacctgaccatcatgtacggcctgaaaggtccgagcatctcgatt
gcgaccgcctgtacctccggcgtgcacaatattggtcatgcggcgcgcatcatcgcgtat
aacgacgcggatgtgatgctggctggtggtgctgagaaagccagtacgccactgggcgtg
ggcggtttcggcgcggcgcgtgcgctctctacccgtaacgacaatccgcaggcggcgagc
cgtccgtgggataaagatcgtgacggtttcgtgttgggcgacggtgccggcatcgtggtg
ctggaagagtacgaacacgcgaaaaaacacggtgcgaagatttatgcggaaatcgttggt
ttcggcatgagcagcgacgcttgccacatgacatcaccaccggaagacggttcaggtgca
gccgcagcgatggtcaacgcgctgcgtgacgcgcagctggatccggcgcagattggctat
gttaatgcgcacggcacctcaacgccggccggtgacaaagcagaagcgcaggcggtgaag
tcggtgtttggtgcgtcagcgcacagcgtgatggtcagctcgaccaagtcgatgaccggt
cacctgctgggtgcggcgggcgcggtagaagcgattaattcgattctggcgctgcgcgac
caggcggttccgccaaccatcaacctcgacaatcctgacgaaggttgcgatctggacttt
gtgccgcatacggcgcgccaggttagcggactggagtacacgctgtgtaactcctttgga
tttggcggcaccaacggctcgctgatcttccgcaaggtataa

DBGET integrated database retrieval system