KEGG   Plautia stali symbiont: E05_39100Help
Entry
E05_39100         CDS       T03051                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
psts  Plautia stali symbiont
Pathway
psts00030  Pentose phosphate pathway
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01120  Microbial metabolism in diverse environments
psts01130  Biosynthesis of antibiotics
psts01200  Carbon metabolism
psts01230  Biosynthesis of amino acids
Module
psts_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psts_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    E05_39100
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    E05_39100
Enzymes [BR:psts01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     E05_39100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAN98676
UniProt: U3U3A1
LinkDB All DBs
Position
complement(3089115..3091106)
Genome map
AA seq 663 aa AA seqDB search
MPSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTNPLWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELQNFRQLHSKTPGHPEYGYTAGVETTTGPLGQGI
ANAVGFAIAERTLAAQFNRPGHDIVDHHTYVFMGDGCMMEGISHEVCSIAGTLKLGKLVA
FYDDNGISIDGHVDGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKKAVEEAKAVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDDEIALTRKQLGWNYAPFEIPSDIYAQWDAKEAG
QAKEKAWDEKFAAYAAAHPELATEFKRRVNNELPANWQAESQKFIEQLQANPAKIASRKA
SQNAIEAFGKLLPEYLGGSADLAPSNLTMWSGSKPINEDAAGNYIHYGVREFGMTAIANG
IALHGGFLPYTATFLMFVEYARNAARMAALMKIRQVMVYTHDSIGLGEDGPTHQPVEQMA
SLRTTPNMSLWRPCDQVESAVAWKYAIERVDGPSALIFSRQNLAQQDRSAEQLANVARGG
YVLKDCDGTPELILIATGSEVELAVGAYEQLSSEGRKVRVVSMPSTDAFDKQDAAYRESV
LPKAVGARIAIEAGIADYWFKYTGLHGAIVGMTTFGESAPAEKLFEEFGFTVANVVKTAK
SVL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgccctctcgtaaagagcttgccaacgccattcgcgcgttaagtatggatgcagtacag
aaagcgaaatcgggacatccgggtgccccaatgggcatggccgatatcgctgaagtgctg
tggcgtgatttcctgaaccacaatccaactaacccgctgtgggcagatcgcgaccgtttc
gtgctgtccaacggccacggctcgatgctgatttacagcctgctgcacctcaccggctat
gacctgccgatgagcgagctgcagaacttccgtcagctgcactctaaaaccccaggccac
ccggaatacggctacaccgcaggcgtagaaaccaccaccggcccactggggcagggcatc
gcgaacgccgtgggcttcgccattgctgagcgcacgctggcggcgcagttcaaccgtccg
ggccatgacatcgtagatcatcacacttacgtgttcatgggcgacggctgcatgatggaa
ggcatctcgcacgaagtgtgctccatcgccggtacccttaaactcggcaagctggtggca
ttctatgacgacaacggcatctctatcgacggtcacgtggatggctggttcaccgacgac
accgccaaacgcttcgaagcctacggctggcacgtggtgcgtggcgtggacggtcacgac
gccgacgcgatcaaaaaagcggtggaagaagccaaagcggtcaccgacaagccatcgctg
ctgatgtgcaaaaccatcatcggtttcggttccccgaacaaagccggtacgcacgattcg
cacggtgccccgctgggtgacgacgaaatcgcgctgacccgcaaacagctgggctggaac
tacgcgccatttgaaattccttctgatatctacgcacagtgggatgctaaagaagccggc
caggcgaaagagaaagcctgggacgagaagtttgctgcttacgccgctgcgcatccggaa
ctggccactgagttcaaacgccgcgtgaacaacgagctgcccgctaactggcaggcggaa
tcgcagaagttcattgagcagctgcaggctaatccggcgaaaatcgccagccgtaaagcg
tcgcagaatgccatcgaagctttcggtaagctgctgccagaatatctgggcggctcggct
gacctggcaccaagcaacctgaccatgtggtccggctcgaagccgatcaatgaagatgcc
gcaggcaactacattcattacggcgtgcgtgagtttggtatgactgccatcgccaacggt
atcgcgctgcacggtggcttcctgccgtacaccgcaaccttcctgatgttcgtcgagtac
gcgcgtaacgcggcacgtatggcggcgctgatgaaaatccgtcaggtgatggtttatacc
cacgactctatcggtctgggtgaagatggcccgacgcaccagccggttgagcagatggcc
agcctgcgcaccactcccaatatgagcctgtggcgtccgtgtgaccaggtagagtctgcg
gtggcgtggaaatacgctatcgagcgcgttgacggcccatcagccctgatcttctcgcgt
caaaacctggcgcagcaggatcgtagcgctgagcagctggctaacgtggcgcgcggtggt
tacgtgctgaaagattgcgacggcacgccggagctgattctgattgcgaccggttctgaa
gttgagctggcggtcggcgcttacgagcagctgagttcggaaggccgcaaggtgcgcgtg
gtgtccatgccgtctaccgatgcgttcgataagcaggatgcggcttatcgtgagtctgtg
ctgccgaaagcggttggcgcacgcattgctatcgaagccggtatcgcggattactggttc
aagtacaccggcctgcacggtgccattgttggcatgaccaccttcggtgagtcagcgcca
gctgagaagctgttcgaagagttcggcttcaccgtggccaacgtggtgaaaaccgcgaaa
tcggttctgtaa

DBGET integrated database retrieval system