KEGG   Plautia stali symbiont: E05_41300Help
Entry
E05_41300         CDS       T03051                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
psts  Plautia stali symbiont
Pathway
psts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01130  Biosynthesis of antibiotics
psts01230  Biosynthesis of amino acids
Module
psts_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    E05_41300
Enzymes [BR:psts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     E05_41300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: BAN98896
UniProt: U3U3W5
LinkDB All DBs
Position
complement(3263444..3264532)
Genome map
AA seq 362 aa AA seqDB search
MEKITVSLGDRSYPITIAAGLFNYPASFWPLKAGDNAMLVTNQTLAPIYLEKLATLLRNV
GVKVDQVILPDGEQYKTLAVMDEVFTALLQKPHGRDTTLIALGGGVIGDLTGFTAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDTDCLTTLPPRELAS
GLAEVIKYGIILDGEFFQWLEQNLDALLALDNTAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAHMGYGNWLHGEAVAAGMVMAARTAERLGQFSAADTDRIIALLQRA
GLPVNGPASMTAEAYLPHMMRDKKVLGGELRLVLPLAIGRSEVRGGVAHDMVLAAINDCK
VS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatcactgtctcactgggggatcgcagttaccccatcaccatcgctgccgga
ctgtttaactatccggcttctttttggccgctgaaagccggcgacaatgccatgctggtg
acgaatcagacgctggcaccgatctatctggaaaaactcgcgacgctgctgcgcaacgtc
ggggtgaaagtggatcaggtgattctgcccgacggtgagcagtacaaaacgctggcggtg
atggacgaggttttcaccgcgctactccagaagccgcacggccgtgacaccacgctgatt
gcactgggtggtggcgtgattggcgatctgaccggttttactgccgccagctaccagcgc
ggtgtgcgatttattcaggtgccgaccaccttgctgtcgcaggttgactcctcggtcggg
ggcaaaactgcggtgaaccatcccctcggtaaaaacatgatcggtgctttctaccagccg
gcttcggtggtggtcgataccgactgcctcactacgctgccgccgcgcgagctggcctcc
ggtctggcggaagtgatcaaatacggcatcattctcgacggtgaatttttccagtggctg
gagcagaatcttgatgcgctgctggcgctggataacactgccatggcttactgcattcgc
cgctgctgcgagctgaaagccgaagtggtggcggccgacgagcgtgaaaccggcctgcgt
gcgctgctcaatctcggtcatacttttggccatgcgattgaagcgcacatgggttacggc
aactggttgcacggtgaagcggttgcggcgggcatggtgatggcggcgcgcaccgctgag
cgtctgggtcagttcagcgctgccgatactgaccgcattattgcgctgctgcagcgtgct
ggcctgccggttaacggcccggccagcatgacggcagaagcctatctgccgcacatgatg
cgcgataaaaaagtgctcggcggcgagctgcgtctggtgctgcctctcgctattggccgc
tctgaagtgcgtggcggcgtagcgcatgatatggtgctggctgcgattaacgattgcaaa
gtatcttga

DBGET integrated database retrieval system