KEGG   Plautia stali symbiont: E05_41310Help
Entry
E05_41310         CDS       T03051                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
psts  Plautia stali symbiont
Pathway
psts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01130  Biosynthesis of antibiotics
psts01230  Biosynthesis of amino acids
Module
psts_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    E05_41310
Enzymes [BR:psts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     E05_41310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA_22 AAA AAA_16 TsaE ABC_tran APS_kinase AAA_25 AAA_5 AAA_7 AAA_17 Ploopntkinase3 AAA_28 AAA_24 RNA_helicase AAA_PrkA AAA_29 His_biosynth RsgA_GTPase Mg_chelatase ATPase_2 AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: BAN98897
UniProt: U3U658
LinkDB All DBs
Position
complement(3264572..3265093)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEAGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDEPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIINMLEKN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggccgatgggtgccggcaaaagcactatt
ggtcgtcagttagctcagcaacttaatatggaatttttcgattccgatcaggaaattgag
cgacgtaccggagcggatgtaggctgggtatttgatgtggaaggcgaagccggttttcgc
gatcgtgaagagaaaatcatcaacgagctgaccgagaaacagggcattgtcctggcgacc
ggtggcggctccgtcaaatcccgtgaaacccgtaatcgtctctccgcccgcggcgtggtc
gtctacctcgaaaccaccatcgaaaagcaacttgcccgcactcagcgtgataaaaagcgt
ccgctgctgcaggttgacgaaccgccgcgcgaggtactggaagcactggctggcgaacgt
aatccactttatgaagagatcgctgacgtcaccattcgcactgacgatcaaagtgcaaaa
gttgtcgccaatcagatcatcaacatgctggaaaaaaattaa

DBGET integrated database retrieval system