KEGG   Plautia stali symbiont: E05_41390Help
Entry
E05_41390         CDS       T03051                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
psts  Plautia stali symbiont
Pathway
psts00550  Peptidoglycan biosynthesis
psts01100  Metabolic pathways
psts01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E05_41390
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    E05_41390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psts01003]
    E05_41390
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psts01011]
    E05_41390
Enzymes [BR:psts01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     E05_41390
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     E05_41390
Glycosyltransferases [BR:psts01003]
 Polysaccharide
  Bacterial polysaccharide
   E05_41390
Peptidoglycan biosynthesis and degradation proteins [BR:psts01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   E05_41390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: BAN98905
UniProt: U3TYG3
LinkDB All DBs
Position
3269032..3271536
Genome map
AA seq 834 aa AA seqDB search
MQGAGTVYGLYKYIEPQLPDVNTLKDVRLQTPMQVYSADGELIAQYGEKRRIPLTLQQMP
PELIKAFIATEDSRFYEHHGVDPVGIFRAASIALVSGHASQGASTITQQLARNFFLSPER
TLMRKIKEAFLAIRIEQLLSKDEILELYLNKIYLGYRAYGAGAAAQVYFGKPVDQLSLSE
MAMIAGLPKAPSTFNPLYSHARALARRNVVLARMLDQNYITQQQYNDARNTPLTASYHGP
EIAFSAPYLTELVRQEMVKRYGDSAYDDGYKVYTTVTRHLQEAAQQAVRNNVMAYDMRHG
YRGPTNVLWKVGEASWDHTRIVNALKDLPVYGPLNAAVVTSASADEATAMLKDGSSVSLT
LAGVRWARPYKSDTLQGPTPHSVTQVLQAGQQIWVRKVGDAWWLGQVPLVNSALVSLNPE
DGAVRALVGGFDFNQSMFNRATQALRQVGSNIKPFLYTAAMDRGLTLASILNDVPISRWD
AGAGADWRPKNSPPTYAGPIRLRQGLGESKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNI
IHTESLALGAASFTPMQVARGYAVMANGGFLVDPYFISKIENEQSGVIFQAQPKIACPQC
NLPVIYGDTKKSVALNEECVENVATSNQQQNQTVPQPELEQVPAQPQPAGDQQYAPHVIN
TPLAFLIKSALNSNIFGEPGWMGTGWRAGRDLKRNDIGGKTGTTNSSKDAWFSGYGPGVV
TSVWIGFDDSRALGRTTVSGAIPDQISGYEGGAKSAQPAWDDYMKVALDGVPVQPLTPPD
GVVTVTIDRSTGKLANGGGNPRQEYFINGTQPTEYSVHDVGTTIMDNGESHELF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
ttgcagggagccggcacggtttatggtttgtacaaatacatagagccgcagctgcctgat
gtgaacacattgaaagatgtgcgcctgcaaaccccgatgcaggtttacagcgcggatggc
gagctgatcgcccagtacggtgaaaaacgccgtatcccgctcaccctgcaacagatgccg
cctgagctaatcaaagcgtttatcgccaccgaagacagccgcttttatgagcatcacggc
gtcgatccggtggggattttccgcgccgccagcatcgcgctggtctccggccacgcctcg
cagggcgccagtaccattacgcagcagctggcgcgtaacttcttcctcagccctgaacgc
acgctgatgcgtaaaatcaaggaagccttcctggcgattcgcatcgagcagttgctgagt
aaggatgaaatccttgagctgtatctgaataaaatctatctcggctatcgcgcttacggc
gccggtgcggcggcgcaggtttacttcggtaaaccggtcgatcagctttcactgagtgag
atggcgatgatcgccggcctgccgaaagcgccgtcgacctttaatccgctctactcgcat
gctcgtgcgctggcgcgccgaaatgtggtgctggctcgcatgctggatcagaactacatc
actcagcagcagtataacgacgcgcgcaacacgccgctgaccgccagctatcacggtccg
gaaattgccttctctgcaccgtatctcaccgagttagtgcgtcaggagatggtgaagcgt
tacggcgacagcgcctatgacgatggctacaaggtgtataccaccgtgacccgccatctg
caggaagccgcacagcaggcggtgcgtaacaacgtgatggcgtacgatatgcgtcacggt
tatcgcggcccgaccaacgtgctgtggaaagtgggcgaagccagctgggatcacacccgc
atcgtcaacgcgctgaaagatctgccggtctacggtccgctgaatgccgccgtggtcacc
agcgctagcgccgacgaagccaccgccatgctgaaagatggcagcagcgtttcgctgacc
ttagcgggcgtgcgctgggcgcgtccgtataaatccgacaccctgcagggaccgacgccg
cacagcgtcactcaggttctgcaggctggccagcagatttgggtacgcaaagtcggggat
gcgtggtggctgggacaggtaccgctggtgaactcggcgctggtgtcgcttaatccggaa
gacggtgcggtacgcgcgctggtaggcggttttgacttcaaccagagtatgttcaaccgc
gccacccaggcgctgcgtcaggtcggctcgaacataaagccgttcctgtataccgccgcc
atggaccgcggcctgacgctggcctccatcctcaacgacgtgccgatttcacgctgggat
gccggtgccggcgcagactggcgaccaaagaactcgccgcctacctatgcgggtccgatt
cgtttacgccaagggctgggtgagtcgaaaaacgtggtgatggtgcgcgcgatgcgtgcc
atgggcgttgattacgccgctgagtatctgcagcgctttggcttcccggcgcagaacatt
atccataccgagtcgctggccctgggcgcagcatccttcacgccaatgcaggtggcgcgc
ggctatgcggtgatggccaacggcggtttcttggtcgatccttacttcatctcgaagatt
gagaacgaacagagcggcgtgattttccaggcgcagccgaagatcgcctgcccgcagtgc
aatctgccggtgatctatggcgacaccaaaaagtcggtggcgctgaatgaagagtgcgtg
gagaacgtcgccacctcgaatcagcagcagaatcagaccgtgccgcagcccgagctggag
caggtaccggcgcagccacagccggccggcgatcagcagtatgcgccgcacgtgatcaac
acgccgctggcgttcctgatcaagagcgcgctgaactctaacatcttcggtgaacccggc
tggatggggaccggctggcgtgccggtcgcgatctgaagcgcaacgatatcggcggcaaa
accggtaccaccaacagttcaaaagacgcctggttctccggttatggtccgggcgtggtg
acgtcggtgtggattggcttcgatgattcgcgcgcgctgggacgcaccacggtatcgggg
gcgattccggatcagatctccggctacgaaggcggcgcgaagagtgcgcagccggcatgg
gatgattacatgaaagtggcgctggatggtgtcccggtgcagccgctgacgccgccggac
ggcgtggtgacggtgaccattgaccgcagcaccggcaagctggccaacggtggcggcaac
ccccgtcaggagtacttcatcaacggcacccagccgaccgagtactcggtgcatgatgtg
ggcaccaccatcatggacaacggtgaaagccacgaactgttttga

DBGET integrated database retrieval system