KEGG   Plautia stali symbiont: E05_41690Help
Entry
E05_41690         CDS       T03051                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psts  Plautia stali symbiont
Pathway
psts00564  Glycerophospholipid metabolism
psts01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    E05_41690
Enzymes [BR:psts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     E05_41690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 FAD_oxidored NAD_binding_8 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: BAN98935
UniProt: U3TYJ3
LinkDB All DBs
Position
3296354..3297865
Genome map
AA seq 503 aa AA seqDB search
METKDLIVIGGGINGAGIAVDAAGRGLSVLMLEERDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRMGLFMYDRLGKRTTLPGS
KGLRFGAESALKPEITRGFEYSDCWVDDARMVVLNAQEVVKQGGEVRTRTRVTRAWLEAG
LWMVEAEDVDTGKTYTWRAKGLVNAAGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
TDEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVKIDDNEISYLLKVYNAQ
FKKQLTSDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDNGQAPLLSVFGGKLTTYR
KLAEHALEKLAKYYPDAGSAWTKNAVLPGGDFSGTREDYAASLRRRYPFISEGMARHFAR
TYGSRTEVLLEGAKSREDLGENFGHEFYEAELRYLVKHEWVCELDDAIWRRTKQGMWLSE
AEQARIRDWLAENGQKPALSLAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtgatcggcggcggcatcaacggtgccggcattgcagta
gatgctgcaggacgcggcctgtcagtgctgatgctggaggagcgggatttggcctgtgca
acctcctctgccagttccaagctgattcacggtggcctgcgctatctggaacattacgaa
ttccgtctggtgggcgaagcgctggccgaacgtgaagtgctgctgaaaatggcgccgcac
atcgcctttccgatgcgtttccgtctgccacaccgcccgcatctgcgtccggcgtggatg
atccgtatgggcctgtttatgtacgatcgtctcggtaagcgcactacgctgccgggcagt
aaaggtctgcgttttggcgcggaatcggccctgaagcccgaaattacgcgcggtttcgaa
tattccgactgctgggtagacgatgcgcgcatggtggtgcttaacgcacaggaagtggta
aaacagggcggcgaagtgcgcacccgcacccgcgtaacccgcgcctggcttgaagccggc
ctgtggatggtggaagcggaagacgtcgataccggcaaaacctacacctggcgtgccaaa
gggctggttaacgcggccggcccctgggtgaagcagttctttgacgatggcctgaagcta
aaatcgccgtacggtattcgcctgatcaaaggcagccatatcgtggtgccgcgcgtgcac
accgacgagaagcaggcttacattctgcagaacgaagataaccgcatcgtgtttgtgatt
ccgtggatggatgagttctcaatcatcggtaccaccgacgtcgaatacaaaggcgatccg
aaaaatgtcaaaatcgatgacaatgaaatcagctacctgctgaaggtttataacgcgcaa
tttaaaaagcagctgaccagcgacgatatcgtctggacctactccggcgtgcgtccgctg
tgcgatgatgaatccgattcaccgcaggcgatcacccgtgattacacgctggacgtgcac
gacgacaatggtcaggcaccgctgctgtccgtgttcggcggcaagctgaccacgtatcgc
aagctggcggagcatgcgctggagaaactggcgaaatactaccccgatgccggctcggcg
tggaccaaaaacgccgtgctgccaggcggtgatttctccggtacgcgtgaagactacgct
gccagcctgcgccgtcgctatccattcatcagcgaaggcatggcgcgtcactttgcccgc
acctacggcagccgtactgaagtgctgctggaaggcgcgaagagccgtgaagatctgggt
gaaaactttggccacgaattctatgaagccgaactgcgttacttggtgaaacacgagtgg
gtgtgcgagctggacgacgccatctggcgccgcactaaacagggtatgtggctgagcgaa
gccgaacaggcgcgcatccgcgactggctggcggaaaacggccagaaaccggcgctgtcg
ctggcttcgtaa

DBGET integrated database retrieval system