KEGG   Plautia stali symbiont: E05_50960
Entry
E05_50960         CDS       T03051                                 

Definition
(GenBank) hypothetical protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
psts  Plautia stali symbiont
Pathway
psts00052  Galactose metabolism
psts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    E05_50960
Enzymes [BR:psts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     E05_50960
SSDB
Motif
Pfam: ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_31 MTS Shikimate_DH Methyltransf_25 Pyr_redox_2 3HCDH_N DUF43 ThiF ELFV_dehydrog PrmA Met_10 Methyltransf_11 PglD_N
Other DBs
NCBI-ProteinID: BAN99862
UniProt: U3U8F8
LinkDB
Position
4012074..4012700
AA seq 208 aa
MTVGLHAMELAGGVEGKEVIIIGAGTIGLLAMQCAAAMGAKSVTAIDINPERLELSKKIG
ATYTYNSAEMSAEEIGKALNERRFDQLVLETAGNPMTVQLAIQIAGPQAQIALIGTLHND
LTVPEKTFGFILRKELRILGSWMNYSGEWPGVEWKQATQLFQDGKIDLASLIAVQGNTDI
YVDAVTALNGKPMNGKIMLDFTTSIPEA
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaccgtcggccttcatgcaatggaactggccggtggtgttgaaggtaaagaggtcatt
attattggcgccggcaccattggtttgctggctatgcaatgtgccgcagcgatgggcgcg
aagtcggtaaccgccattgacattaaccctgaacggcttgaactgtcgaaaaaaatcggt
gccacctacacttataacagcgcggaaatgtccgcagaagagattgggaaagcgctcaac
gaacgccgctttgaccaactggtgctggaaactgcaggcaatccgatgacagtacaactg
gccattcagattgctggtccccaggcgcagattgccctcattggtacactacacaatgac
ctgacagttccggaaaaaacatttggttttattctgcgtaaggaactacgtatcctcggc
agctggatgaactattccggcgagtggccaggggtggaatggaagcaggcaacacagctc
ttccaggacggaaaaattgatcttgcttcgctgattgccgttcagggaaatacagatatt
tatgtagatgcggtcaccgcgcttaatggtaaacccatgaacggaaaaatcatgctcgat
ttcacaaccagtattccggaggcatga

DBGET integrated database retrieval system