KEGG   Pseudomonas stutzeri 28a24: CH92_00660
Entry
CH92_00660        CDS       T03390                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00230  Purine metabolism
pstt00240  Pyrimidine metabolism
pstt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CH92_00660
   00240 Pyrimidine metabolism
    CH92_00660
Enzymes [BR:pstt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     CH92_00660
    3.2.2.-  
     CH92_00660
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AHL73684
UniProt: W8QTT8
LinkDB
Position
complement(138142..139515)
AA seq 457 aa
MTSRYVINASVSPKGSLETLSQREVQQLSEASSGTTYTLFRQCVLAILNTGARIDNAKTV
LEAYDDFEVRIHQQDRGVRLELLNAPADAFVDGEMIASTREMLFSALRDIVYTESELGSP
RIDLSSSQGITDYVFHLLRNARTLRPGVEPNMVVCWGGHSISTEEYKYSKRVGHELGLRK
LNICTGCGPGVMKGPMKGATIAHAKQRILAGRYLGLTEPGIIAAEAPNPIVNELVILPDI
EKRLEAFVRVGHGIIIFPGGVGTAEEFLYLLGILLHPDNRDVPFPVILTGPESAAPYLEQ
IRDFVGATLGEKAQSLYQIIIDNPAEVARQMVEGLKAVKQFRRERNDAFHFNWLLKIEEG
FQRPFDPTHENMASLQLTRAVPPHELAANLRRAFSGIVAGNVKDTGIRRIEQFGRYEIHG
DPAIMKPLDKLLQAFVEQHRMKLPGGRPYEPCYRVVT
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgacctcacgctacgtaatcaatgcctcggtaagccccaagggcagcctggaaacgcta
tcccaacgagaagttcaacaactgagcgaagccagttcaggcacgacctacacgctgttc
cgccaatgcgtcctggcgattctcaacaccggtgcgcgcatcgataacgccaaaaccgtt
ctcgaagcctacgacgacttcgaagtgcgcattcaccaacaggatcgcggcgtgcgcctg
gaactgctcaacgcgcccgccgatgccttcgtcgatggcgagatgatcgccagcacccgg
gagatgctcttcagcgcgctgcgtgacatcgtctacaccgagagcgagctgggcagtccg
cgtatcgacctcagcagctcccaaggcatcaccgactacgtattccatctgctgcgcaat
gctcgcacgctgcgcccaggggtcgagccgaacatggtggtttgctggggcggccactcg
atcagcaccgaggaatacaaatacagcaagcgcgttggccacgaactggggttgcgtaag
ctgaacatctgcaccggttgcgggcctggcgtgatgaagggcccgatgaagggcgcgacc
atagcccatgccaaacaacgcattctcgctggccgttacctggggctgaccgaaccgggc
atcatcgccgccgaggcgccgaacccgatcgtcaacgagctggtgatcctgccggatatc
gaaaagcgccttgaagccttcgttcgtgtcggtcacggcatcatcatcttcccaggtggc
gtcggtacggcagaagaattcctctacctgctgggcattctgctgcatccggacaaccgt
gacgtgcccttcccggtcatcctcaccggcccggaaagcgccgcgccgtacctggagcag
attcgcgatttcgtcggcgccacgctcggcgaaaaagcccagagcctctaccagatcatt
atcgacaacccggccgaggtggcgcggcagatggtcgaggggttgaaggccgtcaagcag
ttccgccgcgaacgcaacgatgccttccatttcaactggctattgaagatcgaggaaggc
ttccagcgccccttcgatccgacccatgaaaacatggccagcctgcagctgacccgagcc
gtgccgcctcatgagctggcagcgaatctgcgacgggcgttctccgggatcgtcgcgggg
aacgtcaaggacactggcatccgccgcatcgagcagttcggccgctacgaaatccacggc
gatccagcgatcatgaagcccctggacaagctgctgcaggcattcgtcgaacagcaccgg
atgaaactgcccggcggccgcccgtacgagccgtgctatcgcgtggtgacctga

DBGET integrated database retrieval system