KEGG   Pseudomonas stutzeri 28a24: CH92_06405Help
Entry
CH92_06405        CDS       T03390                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00061  Fatty acid biosynthesis
pstt00780  Biotin metabolism
pstt01100  Metabolic pathways
pstt01212  Fatty acid metabolism
Module
pstt_M00083  Fatty acid biosynthesis, elongation
pstt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH92_06405
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH92_06405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pstt01004]
    CH92_06405
Enzymes [BR:pstt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CH92_06405
Lipid biosynthesis proteins [BR:pstt01004]
 Fatty acid synthase
  Component type
   CH92_06405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas AfsA 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHL74752
UniProt: W8R8R6
LinkDB All DBs
Position
1355771..1356211
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVELDTDAKRVRAYKNVTINEPFFNGHFPQHPIMPGVL
IIEAMAQAAGLLGFKMMGVKPADGTLYYFVGSDKLRFRQPVVPGDQLTLEATFISAKRGI
WKFDCRASVDGKPVCSAEIICAEQKI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggatatcaacgagattcgcgaataccttccccaccgttacccctttctgctggtc
gatcgggtggtggagctggacacggatgccaagcgggttcgcgcctacaagaacgtcacc
atcaacgaaccgttcttcaacgggcatttccctcagcacccgatcatgccgggcgtgttg
atcatcgaggcgatggcgcaggccgccgggctgctcggtttcaagatgatgggggtgaag
ccagccgacggcacactttattatttcgtcggttcggacaagttgcgttttcgccagccc
gtcgtaccgggcgatcagctgactctcgaagcaaccttcatcagtgccaaacgtgggata
tggaagttcgattgccgcgccagcgttgatggcaaacccgtatgctctgccgaaatcatt
tgtgcggaacagaaaatatga

DBGET integrated database retrieval system