KEGG   Pseudomonas stutzeri 28a24: CH92_07650Help
Entry
CH92_07650        CDS       T03390                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01130  Biosynthesis of antibiotics
pstt01230  Biosynthesis of amino acids
pstt02024  Quorum sensing
Module
pstt_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH92_07650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH92_07650
Enzymes [BR:pstt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CH92_07650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AHL74981
UniProt: W8RSE9
LinkDB All DBs
Position
1606691..1607761
Genome map
AA seq 356 aa AA seqDB search
MNAPISAQLVDCNPHAAPSKRSAHPLPSPAVLRQRLPLSAALATRIHADRSAIRAVLDGS
DPRLLVVVGPCSLHDPESALEYAERLAELAPQVDDRLLLVMRAYVEKPRTTIGWKGLVYD
PHLDGSGDMAEGLSLSRRLMMDILERGLPIATELLQPLAAGYFEDLLGWAAIGARTSESQ
IHRELVSGLDLPVGFKNGTDGSLGIACDAMRSAEHAHQHFGIDDLGHPALVQTRGNPDTH
LVLRGGHAGPNYDEKSVTLAREVLLRQRIAPRIMVDCSHANSGKDPLRQPAVLDAVIDQR
LAGESSLRGVMLESHLFDGCQSLAGSLRYGVSITDGCLGWVATERMLRQAAVRLRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgatttccgctcaactcgtcgattgcaatccccacgctgccccgtctaaa
cgcagcgctcatccgttgcccagtcccgccgttctgcgtcagcgcctgccgctcagtgcc
gcgctcgccacacgcatccatgccgaccgcagcgccatccgcgccgtgctcgatggcagc
gacccgcggctgctcgtcgtggtcggcccgtgctcgctgcacgatcctgaatccgcactt
gaatacgccgagcgcctcgctgagctggcgcctcaggttgatgatcggctgctgctggtg
atgcgggcctacgtggaaaagccgcggaccacgatcggttggaaagggctggtctacgat
ccccacctggacggcagtggcgatatggccgaaggcctgagcctgtcacgtcggttgatg
atggacattctcgagcgcggtctgccgatcgccaccgaattgctgcagcccttggcagcc
ggctatttcgaggacctgttgggatgggccgccattggcgcgcgtaccagcgaatcgcag
attcatcgggaactggtgagcggcctggatctgccggtgggcttcaagaatggcaccgac
ggcagccttggaatcgcctgcgatgccatgcgctcggccgagcacgcgcaccagcacttc
ggcatcgacgaccttgggcatccggcgttggtgcagacccgtggtaatccggatacccat
ttggtgttgcgtggtgggcacgctgggccgaactatgacgaaaagagcgtcaccctggca
cgcgaagtgttgctacgccagcgcatcgcgccgcggatcatggtcgattgcagccatgcc
aacagcggcaaggacccgttgcgtcagccggcagtgctggacgctgtcatcgatcagcgc
ctggctggagagtcgagcctgcgcggggtgatgctagaaagtcacctgttcgatggctgt
cagtctctggccggaagcctgcgttatggcgtctccatcaccgatggctgcctaggctgg
gtggcaaccgagcggatgctgcgccaagccgcggtgcgcctacgcggataa

DBGET integrated database retrieval system