KEGG   Pseudomonas stutzeri 28a24: CH92_08375Help
Entry
CH92_08375        CDS       T03390                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01130  Biosynthesis of antibiotics
pstt01230  Biosynthesis of amino acids
Module
pstt_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH92_08375
Enzymes [BR:pstt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     CH92_08375
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     CH92_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HNHc_6 XOO_2897-deam
Motif
Other DBs
NCBI-ProteinID: AHL75120
UniProt: W8QWY5
LinkDB All DBs
Position
1758803..1759900
Genome map
AA seq 365 aa AA seqDB search
MSDVDRLKALRVRIDSLDEKILELISERARCAQDVARVKTASLAEGEEAVFYRPEREAWV
LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGQAVI
SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL
LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA
GDMAAQLYGLTKIAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMRNKPGALHELL
MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCIGHHQDPLIKDVLEKIGREAVALKVLGSY
PKAVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcgatcggctgaaggcgctgcgtgtacgcatcgacagtctcgacgagaag
attctcgagctgatcagcgagcgggcccgttgcgctcaggacgtggcgcgagtcaagacc
gcatcactggccgagggtgaggaggcggtgttttaccgtcccgagcgtgaagcctgggtc
ctcaagcacatcatggagttgaacaaagggcctctcgataacgaggagatggcgcgcctt
ttccgcgaaatcatgtcgtcctgcctggcgctggagcaaccgctgcgggtcgcttatctc
ggacctgaagggactttctcccaggctgctgcactgaaacattttggtcaggcggtgatc
agcaagccgatggcagcgatcgacgaagtctttcgcgaagtggtcgccggtgcggtcaat
ttcggcgtggtgcctgtagaaaactctaccgaaggcgcggttaaccacaccctcgacagt
tttctcgagcacgatatcgtcatctgcggcgaagtcgagttgcggatccaccatcatctg
ctggtgggcgaaacgaccaagacggatcgcatcacacgtatttattcccatgcacagtcg
ctggcgcagtgccgcaagtggcttgatgcgcattacccgaacgtcgaacgcgtggcggtt
tccagcaatgccgacgcggccaaacgcgtcaagagcgagtggaactccgccgcgattgcg
ggcgatatggcggctcagctttacggcttgaccaagatcgccgagaagatcgaagaccgc
ccggacaattccacgcgctttctgatcatcggcaaccaggaagtgccacccaccggcgac
gacaagacgtcgatcatcgtctctatgcgtaacaagccgggcgcactgcacgagttgctg
atgccgtttcactccaatggcatcgatctcacgcggatcgaaacccgtccttcacgcagc
ggaaaatggacctacgtattcttcatcgattgcataggccatcaccaggatccgctgatc
aaagacgtgctggagaagatcggccgcgaagcggtggcattgaaggtgctggggtcttat
ccgaaagcggtactttaa

DBGET integrated database retrieval system