KEGG   Pseudomonas stutzeri 28a24: CH92_11405Help
Entry
CH92_11405        CDS       T03390                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00500  Starch and sucrose metabolism
pstt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CH92_11405
Enzymes [BR:pstt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CH92_11405
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CH92_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AHL75680
UniProt: W8QYF7
LinkDB All DBs
Position
complement(2417063..2420383)
Genome map
AA seq 1106 aa AA seqDB search
MAKARKPAAFIKDPLWYKDAVVYQVHLKSFYDSNNDGVGDFQGLIEKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHPDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKKGSAARDFYVWSDTDEKYDGTRIIFLDTEVSNWTWDPVAQQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDLGIDGLRLDAIPYLVERDGTNNENLPETHVVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGGEDGGLGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPDIPENCQWAIFLRNHDELTLEMVTDKERDYLWNYYASDKRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIFLGDRDGVRTPMQWSVDRNGG
FSRADPPSLVLPPIMDPLYGYQAINVEAQQRDPHSLLNWTRRLLSIRKQFKAFGRGTLKM
LAPSNRRILAYVREFTTGTGETETIFCVANVSRSAQAAELELSHYAGMVPVEMVGGSAFP
PIGQLPYLLTLPPFGFYWFQLATSHQMPSWHQEPVETMPDFQTLVLKRLDTLTTANKRIL
ETESLPAYLPKRRWFASKDASINSIKICYSVPFGDPQKPVLLSEIAVDAGGRTDLYQLPL
GFLGEADFDIALPQQLAMARVRRGPQVGLLTDAFALNQFVLGVIQGLREEQVLPCGDGEI
RFQPMAQLAEMELPADAEVRYLTAEQSNSSAIIGGSMMIKVLRRVSAGMHPELEMGGFLT
EQGFTHISAMLGQVSRFDKSGEQYALMVVQRFLDNQGDAWEWTLNTLDRAVRDQIAGGVS
LHENQFSALEELEAFNRLLGQRLGEMHMTLAVQTDNQAFAAEPTKAADAKEWTQLISAQV
EHALDLLQARRGDLDRKSTALVDQLLGQRKGLVAEVKRLADRTLGGLRTRVHGDLHLGQI
LVAQGDAYFIDFEGEPARSLEERRSKLSPFKDVAGVLRSFEYATAMTLRNAQSSDSSEAA
DLARRNISDTYQQSARNVFLEAYREATAQMPHAWKDDAGADAALALFSLEKTAYEVAYEA
ENRPAWLSVPLQGLAVLAQQISNGGS
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcgcgtaaaccagccgcctttatcaaggatcctctctggtacaaggacgcg
gtggtctatcaggtccacctcaaatcgttctacgactcgaacaacgacggcgtcggcgat
tttcagggcctgatcgagaagctcgattacatagccgatctcggcgtcaacaccatttgg
ctgttgccattctatccctcgccacgccgtgatgacggctacgacatcgccgaataccgc
ggtgtgcatcccgactacgggaccatggccgacgccaagcgattcattgcagaagcgcac
aaacgcgggctgcgggtgataaccgaattggtcatcaaccacacctcggaccagcaccct
tggttccaacgcgcgcgtaaggcgaagaagggttcggctgcccgggacttctacgtctgg
tcggatacggacgaaaagtacgacggcacgcggatcatcttcctcgacactgaggtctcg
aactggacctgggaccccgtcgcccagcagtacttctggcaccgcttctattcccatcag
ccggatctcaatttcgataacccgcaggttatgaaagcggtgctcagtgtgatgcgttac
tggctcgacctgggtatcgatgggttgcggctggacgcgatcccgtatctcgtagagcgc
gacggcactaacaacgagaacctgccggaaacccatgtggtgctgaagcagattcgcgcc
gagatcgatgccaattacccggaccgcatgctcctggcagaagccaaccaatggccggaa
gacacccagctgtactttggcggcgaagatggcggacttggcgatgagtgccacatggca
ttccactttccgctgatgccgcgcatgtacatggcgctggcccaggaagaccgtttcccg
attaccgatattctgcgccagaccccggacattccagagaactgtcagtgggcgatcttc
ctgcgtaaccatgacgaactgacgcttgaaatggtgaccgacaaggagcgcgactacctc
tggaactactacgcctcggacaagcgcgcgcggatcaatcttggcattcgtcggcgcctg
gcaccgttgctggagcgcgatcgccggcgcatcgaattgctcaacagcctgttgctgtcg
atgcctggtacgccggtgatctattacggtgacgagatcggcatgggcgacaacatcttc
cttggtgatcgcgacggggtgcgcacgccaatgcagtggtcggtggaccgcaacggtggt
ttttctcgcgccgacccgccaagcctggtgctgccgccgatcatggaccccttgtatggc
tatcaggcgatcaacgtcgaagcgcagcagcgcgatccgcattccttgctcaactggacg
cggcgtctgctgtcaattcgtaagcaattcaaggcgttcggccgtggcacgctgaaaatg
ctcgcacccagcaaccgccgaattctcgcctacgtccgtgagttcacgacaggtaccggt
gaaaccgaaacgattttctgtgtcgccaacgtttcgcgatctgcccaagcggcagaactg
gaactgtcgcactacgccggcatggtgccggtggaaatggtcggcggcagtgcgttcccg
cctatcggccagttgccttatcttctgacgttgccaccgttcggcttctactggttccaa
ttggcgaccagtcatcagatgcccagctggcaccaggaaccggtggaaaccatgcctgac
ttccaaactcttgtgctcaagcgtctggacacgctgacaacggcgaacaaacgtattctt
gaaaccgagtcgcttccggcttacctgccgaagcggcgttggttcgccagcaaggatgca
tcgatcaactcgatcaagatttgctacagcgtgccgtttggcgatccccaaaagcccgtg
ttgctgagcgaaatcgcggtcgatgcaggcgggcgcactgacctctaccaactgccgctg
ggtttcctcggcgaggcggatttcgatatcgcgctgccgcagcaactggcaatggcgcgt
gtccgccgcggcccacaggtcggtctgctgaccgatgcgttcgccctcaaccagttcgtc
ctgggagtcatccaggggctgcgcgaagagcaagtgctgccatgtggcgacggcgagatc
cgcttccagcctatggcacagctcgccgagatggaattgccggccgatgccgaggtgcgt
tacctcactgcagaacaatcgaacagctctgcgatcatcggtggcagcatgatgatcaaa
gtgcttcgccgagtatcggccggcatgcaccctgaactggaaatgggcggcttcctgacc
gagcagggcttcacgcatatctctgcgatgctgggccaggtgagccgcttcgataagagc
ggcgagcagtacgcattgatggttgtgcaacgcttcctcgacaaccagggcgatgcctgg
gagtggacgctcaacacgctggatcgcgcagtgcgcgaccagattgccggtggcgtttcg
ctgcatgagaaccagttcagtgcgctggaagaactcgaggccttcaataggttgcttggc
cagcgtctcggcgaaatgcacatgaccttggcggtgcagaccgacaaccaggcgtttgcc
gccgaacccaccaaagcggccgacgcgaaggagtggactcagttgatctctgcgcaggtc
gagcatgcgcttgatctgctgcaggctcgtcggggcgatctggatcgtaaatccacagcg
ctggtggatcagctgcttggccagcgcaaggggttggtggccgaggtcaagcgactcgct
gatcgaaccctcggcgggttgcgtacacgcgtccacggcgacttgcacctcggccagatc
ctggttgcgcagggcgacgcgtatttcatcgacttcgaaggcgaacctgcgcgttcgcta
gaagagcggcgtagcaagctgagcccgttcaaagacgttgcgggcgtactgcgctctttc
gagtacgccacggcaatgaccctgcgcaacgctcaatccagcgacagctcagaagcggct
gacctggcgcgacgcaatatttccgacacctaccaacagagcgcacgtaacgtctttctc
gaggcctatcgcgaggcaacagcgcaaatgccgcacgcctggaaagatgacgccggtgcc
gatgctgcgctggcactcttcagcctggaaaagaccgcgtatgaagtggcctatgaagca
gagaaccgcccggcctggctgtctgtcccattgcaagggctcgcagttctggcacaacag
atttccaatggaggttcctaa

DBGET integrated database retrieval system