KEGG   Pseudomonas stutzeri 28a24: CH92_12615Help
Entry
CH92_12615        CDS       T03390                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH92_12615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pstt02000]
    CH92_12615
Enzymes [BR:pstt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH92_12615
Transporters [BR:pstt02000]
 Other Transporters
  Pores ion channels [TC:1]
   CH92_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AHL75891
UniProt: W8RUY2
LinkDB All DBs
Position
2703633..2704304
Genome map
AA seq 223 aa AA seqDB search
MLTLHHLDNSRSQRVLWLLEELQLPYEIKRYARNPQTMLAPPELKNVHPLGKSPVITDGE
LTLAESAAILEYLVERYGDGQLTPPRGSPEHLRFRYWMHYAEGSAMPPLLLKLIFDRIGN
GPMPFFIRPVARAIAKGANKAFIGPQLKLHLDYMESELGKSQWFAGGEFSVADIQMSFPL
EAAQSRAGLDASRPKLTAFLQRIRDRPAYQRAVERGGPVMPGR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctgcaccacttggacaattcccgctcgcaacgcgtgctctggctgctggaa
gaactgcaactaccgtacgagatcaagcgctacgccagaaatccgcagaccatgctggct
ccgcctgaactgaagaatgtgcatccgcttggcaaatcgcccgtcatcaccgacggcgag
ctgactctggccgagtcagctgcaatccttgagtatctggtcgagcgctatggtgatggc
caactgaccccacccagaggttcacctgaacaccttcgatttcgctactggatgcattac
gccgaaggttcagcgatgccgccgctgcttctcaagttgatattcgatcgtatcggtaac
gggccgatgccatttttcattcgtccagtggcccgagcaatcgccaaaggtgccaacaag
gcttttatcggtccacagctaaagctccacctggactacatggagagcgagctagggaaa
agccaatggtttgccgggggggaattcagcgtcgcggatattcagatgagcttcccgctc
gaagccgctcaatcgcgcgcaggcctggatgccagccgcccgaaactgactgcatttttg
caaaggatacgtgaccgccccgcttatcagcgagccgtagaacggggtggtccggtaatg
cctgggcgctag

DBGET integrated database retrieval system