KEGG   Pseudomonas stutzeri 28a24: CH92_13035
Entry
CH92_13035        CDS       T03390                                 

Definition
(GenBank) 50S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pstt  Pseudomonas stutzeri 28a24
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pstt03009]
    CH92_13035
Enzymes [BR:pstt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     CH92_13035
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     CH92_13035
Ribosome biogenesis [BR:pstt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CH92_13035
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP MTS Methyltransf_25 Methyltransf_24 Methyltransf_31 Methyltransf_15 PrmA
Other DBs
NCBI-ProteinID: AHL75966
UniProt: W8RV67
LinkDB
Position
complement(2799526..2801706)
AA seq 726 aa
MTDRHELILTCPKGLEGLLLEEAIGLGLEEAREQTAAIRGFANMEVAYRLCLWSRLANRV
LLVIHRFATVNAETLYEGVHQVDWSEHLEATGSLAVEFSGHGSGIDNTHFGALKVKDAIV
DRLRTASGERPSVDKLNPDLRVHLRLDRGQAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRAGWPRIAAAGGALTDPMCGVGTFLIEGALMAADVAPNLRRERWGFSAWLGHVP
AIWNRLHAEAKARAEAGLARKPLWIRGYEADPRLIQPAKNNIERAGLANWIRVYQGDVAT
FEPRPDQHQKGLVICNPPYGERLGDEASLVYLYQNLGERLRQACLGWEAAVLTSAPDLGK
RTGIRSHKQYAFWNGALPCKLLLIKVELDQFVTGQRKASVESTIEEQPAAELARLSEGGQ
MFANRLQKNLKLLGKWARREGIQCYRLYDADMPEYALAIDLYGDWVHVQEYAPPRSIDPE
KAQARLYDALGAIPQALGISRDRVVVKRRERQSGTRQYERQASQGEFLEVREGDIKLLVN
LTDYLDTGLFLDHRPLRLRIAREAADKRFLNLYCYTATATVHAVKGGARSTTSVDLSKTY
LDWARRNLALNGLSDRQRLEQADVMAWLEEDRGEYDLIFIDPPTFSNSKRMEGVFDVQRD
HVALLDLAMARLATGGTLYFSNNFRKFVLDTGITERYAVEEITGATLDEDFRRNSKIHRA
WKLQAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgactgatcgccacgaactcatcctcacctgccccaaggggctggaaggtctgttgctt
gaagaggccattggcctcggacttgaggaggcgcgcgagcagaccgcagcgatccgaggg
tttgccaacatggaggttgcgtatcggctgtgcctctggtcgcgtctggccaatcgagtg
ttgctggtgatccatcgtttcgccacggtaaatgccgagactctgtatgaaggcgttcac
caggtggactggtcggaacatctcgaggctaccggcagcctggccgtcgaattcagcggt
catggatcgggaatcgacaatactcactttggtgcgctgaaggtaaaggacgcgatcgtc
gatcgccttcgaacggcatccggcgagcgcccgagtgtcgacaagctgaatccggatctt
cgtgtacatctgcggctcgatcgcggtcaggcgatcctttcattggatctttccgggcac
agcctgcaccagcgcggctaccgcctgcagcagggcgccgcgcccctgaaggagaacctg
gcggccgccgtgctgattcgcgcgggctggccccgtatcgccgcagcgggtggcgcgctg
acggacccgatgtgtggcgtgggtacctttcttatcgaaggtgcgctgatggccgctgat
gtcgcgcccaatctgcgtcgtgagcgctgggggttcagtgcgtggttagggcatgttcca
gccatttggaaccgtctgcatgccgaagcgaaggcgcgcgccgaagcgggactggccaga
aagccgttgtggatacggggttacgaggcggatccgcggctgatacagccggccaagaac
aatatcgagcgcgccggcctggcgaactggatccgtgtctaccagggcgatgtcgccacg
tttgagccgcgccccgatcagcaccagaagggattagtgatctgcaacccgccctacggc
gagcggttgggcgatgaagcgagcctggtctatctctatcagaatctcggagaacgcctg
cgacaagcctgcctcggttgggaagctgcggtgctgacatctgcaccggatcttggcaag
cgcacgggtatccgcagtcacaagcaatacgccttctggaatggtgcgctgccgtgcaag
ctgttgttgatcaaggtcgagttggatcagttcgttaccggacagcgcaaggcttcggtt
gagagcacgatcgaggagcagcccgccgcggagctggcgcgcctcagtgaaggtggtcag
atgttcgccaaccggctgcaaaagaatctgaagctgctcggcaagtgggctcgtagggaa
ggcatccaatgctatcggctatacgacgccgacatgcccgagtatgccctggccatcgat
ctgtatggtgactgggtgcatgtgcaggaatatgcaccgccgcgttcgatcgatccggag
aaagcgcaggcgcgtctgtacgacgcgctgggtgcgatcccccaagcgttgggtatttcc
cgcgaccgtgtggtggtcaaacgccgcgagcgtcagagcgggacgcgccagtacgagcgc
caagccagtcagggcgagttcctcgaagtgagggagggcgacatcaagttactggtgaat
ctcaccgattatctcgataccggactgtttctcgatcatcgcccgctgcgcctgcgcatc
gcgcgcgaagcggctgacaagcgctttctgaacctgtactgctatacggccacggccacc
gtgcacgctgtcaaaggtggcgctcgcagcactaccagcgtcgatctatcgaaaacctat
ctggactgggcacggcgcaatctagccctcaacggcttgtccgatcggcagcgtctggag
caggcggatgtgatggcatggctggaggaggatcgtggcgagtacgatctgatcttcatc
gacccgccgaccttctccaattcgaagcgaatggaaggtgttttcgatgtccagcgtgat
catgtcgccttgctcgatctcgccatggcgcggctggcaaccggcggtacgctgtatttt
tccaacaacttccgcaagttcgtgctcgacacgggcatcaccgagcgctacgcggtggag
gaaatcaccggcgccacactggacgaggatttccggcgcaacagcaagatccatcgcgcc
tggaagctccaggcgcgatga

DBGET integrated database retrieval system