KEGG   Pseudomonas stutzeri 28a24: CH92_16335Help
Entry
CH92_16335        CDS       T03390                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pstt  Pseudomonas stutzeri 28a24
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CH92_16335
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CH92_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Glutaredoxin FMO-like K_oxygenase Thi4 NAD_binding_8 HTH_43
Motif
Other DBs
NCBI-ProteinID: AHL76580
UniProt: W8R133
LinkDB All DBs
Position
complement(3527356..3528921)
Genome map
AA seq 521 aa AA seqDB search
MLDSNLKTQLKTYLEKVTQPFEIVASLDDGAKSQEMLSLLEEIASLSDKITLRADGNDDR
RPSFALNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPDIIEQIKNLDVEYNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQEEVTARQVMSVPSIYLNGELF
GQGRMGEEEILAKLDTGASARDAEKLSAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVNETEGPKLARALENHVREYDVDIMNLQRAAALIPASSQGD
LHEIKLESGASLKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAQVTLLEFDSQLRADAVLQKKLHSLPNVTVITSALTSEVIGDG
KKVTGLTYKDRNSSEFHSLELEGIFVQIGLLPNSDWLKGTVELTSRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSVDD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggactccaatctcaaaacgcaactgaaaacctacctggaaaaggtcacccagccg
ttcgagatcgtcgcgtccctcgatgacggtgccaaatcccaggaaatgcttagcctgctg
gaagaaatcgccagcctgagcgacaagatcaccctgcgcgccgatggcaatgatgatcgt
cgtccgtcgttcgcgctcaaccgcatcggcggcaatatcagcctgcgcttcgccggcatt
ccgatggggcatgagttcacctccctggtgctcgcactgctgcaggtcggcgggcatccg
tccaagaccgcgccggacatcatcgagcagatcaagaacctcgatgttgaatacaacttc
gaaacctacttctcgttgtcctgccagaactgcccggacgtggtccaggcgttgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggtgcgctgttccaggag
gaggttaccgctcgccaggtcatgtcggtgccgagcatttacctcaacggcgaactgttc
ggccagggtcgcatgggtgaggaagagatcctcgccaagctcgacaccggcgcctcggcg
cgtgacgctgagaagctcagcgccaaggacgcctttgacgtgctcgtcgttggcggcggg
cctgccggcgccgctgcggccatttatgccgcgcgcaagggcatccgtaccggtgttgcg
gctgagcgtttcggcggtcaggtgctggacaccatggccatcgagaacttcatctcggtc
aacgaaaccgaaggcccgaaactggcccgcgcgctggaaaaccacgtgcgtgaatacgac
gtcgacatcatgaatctgcagcgtgccgcggcactgattccggcctcgagccaaggcgat
ctgcatgagatcaaactggagagcggcgcttcgctaaaagccaagacactgatcctggcg
accggtgcgcgttggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgaggc
gtcgcctactgtccgcattgcgacggcccgctgttcaagggcaagcgtgtggcggtgatc
ggtggtggcaactcgggtgtggaagcggccatcgacctggccggtattgtcgctcaggtg
accctgctcgagttcgacagccagctgcgcgccgatgccgtgctgcagaagaagctgcac
agcctgcctaacgtcaccgtgatcaccagcgcgctgaccagcgaagttatcggcgacggc
aagaaagtcaccggcctgacttacaaggatcgcaactccagcgaattccacagcctggaa
ctcgaaggcatcttcgtgcagatcggcttgctgcccaactccgactggctgaaaggcacc
gtggagctgacctcgcgtggcgagatcatcgtcgatgcacgtggcgagacctcgctgcca
ggtatcttcgccgctggtgatgtcaccaccgtgccgtacaagcagatcgtcattgctgtc
ggcgaaggggccaaggcctcgctgagtgccttcgaccacctaatacgtagctccgtcgac
gactga

DBGET integrated database retrieval system