KEGG   Pseudomonas stutzeri 28a24: CH92_16870Help
Entry
CH92_16870        CDS       T03390                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00473  D-Alanine metabolism
pstt00550  Peptidoglycan biosynthesis
pstt01100  Metabolic pathways
pstt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CH92_16870
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH92_16870
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CH92_16870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pstt01011]
    CH92_16870
Enzymes [BR:pstt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CH92_16870
Peptidoglycan biosynthesis and degradation proteins [BR:pstt01011]
 Precursor biosynthesis
  Amino acid ligase
   CH92_16870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_Ter ATP-grasp ATP-grasp_4 ATP-grasp_3 RimK ATP-grasp_5 TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHL76672
UniProt: W8RDV5
LinkDB All DBs
Position
complement(3639267..3640211)
Genome map
AA seq 314 aa AA seqDB search
MTALQSTRDPQAFGRVAVLLGGKSAEREVSLKSGAAVLAALQAAGVDAFGIDVGDDLLTR
LSSEHIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGL
PTPRHAVLASEADCHAAAETLGFPLIVKPAHEGSSIGMAKVGGIAELIAAWRAASAYDAQ
VLVEQWIQGPEFTIATLRGAVLPPIGLGTPHTFYDYDAKYVANDTQYRIPCGLDAVKEQE
LRDLSARACEAVGIQGWARVDVMQDSAGAFWLLEVNTVPGMTDHSLVPMAARAAGLDFQQ
LVLAILDASMTVGH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctgcaatcgactcgtgatccccaggctttcggccgggtcgccgtgctcctc
ggcggtaagagtgccgagcgcgaggtgtccctgaaatccggcgctgcggtgctggcggcg
ttgcaggctgcgggcgtcgatgcgttcggcatcgatgtcggtgatgacctgctgacgcgc
ctgagcagcgaacatatcgatcgtgcgttcatcgtgctgcacgggcgcggcggcgaagac
ggcagcatgcagggcctgctcgaatgcgccgggattccctataccggcagcggcattctc
gcgtccgcgctggccatggacaagctgcgcaccaagcaggtctggcagagcctcggcctg
ccgaccccgcgacatgccgtgctggcgagcgaggcggattgccatgccgctgcggagacg
ctgggctttccattgatcgtaaagccggcgcatgaaggctccagcatcggtatggcgaag
gttggcggcatcgctgagctgatcgccgcctggcgcgcagcgagtgcctacgatgctcag
gtactggttgagcaatggatccaggggcctgaattcaccatcgccacgctgcgcggcgca
gtacttccaccgattggtctgggcacccctcacaccttctacgactacgacgccaagtac
gtggccaacgatacccagtaccgcattccctgcggtttggatgcggtcaaagagcaggaa
ctcagagatctctccgcgcgtgcctgcgaagccgtagggatccagggctgggcccgtgtc
gatgtcatgcaggacagtgccggcgctttctggctgctggaagtgaacacggtgccggga
atgaccgatcacagcctggtgccgatggcggcgcgtgccgcagggctggatttccagcag
ctggtgctggccattctcgatgccagcatgacggtaggacactaa

DBGET integrated database retrieval system