KEGG   Pseudomonas stutzeri 19SMN4: UIB01_00025Help
Entry
UIB01_00025       CDS       T03366                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UIB01_00025
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UIB01_00025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AHY40917
UniProt: A0A023WL72
LinkDB All DBs
Position
6448..8010
Genome map
AA seq 520 aa AA seqDB search
MLDTNLKTQLKAYLEKVTQPFEIVASLDDGEKSREMLNLLQDIAGLSDKITLKTDGDDAR
KPSFSLNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKALEGDYSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLKAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYDVDIMNLQRASKLIPAGDDGL
HRVQFENGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEELRADAVLQRKLFSLPNVRVLKMAQTTEVKGDGQ
KVTGLVYKDRSSEDMHTVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaaatcccgggaaatgctgaacctgttg
caagacatcgccggcctcagcgacaagatcaccctcaagaccgacggcgacgatgcacgc
aagccgtcgttctcgctcaaccgcatcggcggcaacatcagcctgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggccttgctgcaggtcggtggccacccg
tcgaagaccgcgccggaagtgatcgagcagatcaaggcgctggagggcgactacagcttc
gaaacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcactgaacctt
atggccgtgctcaacccgaacatcaagcacgtggccatcgacggcgcgctgttccaggac
gaagtcgaggcgcgccagatcatgtcggtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaagaagaaatccttgccaagctcgacaccggctccagcgcc
cgtgatgccgagaagctcaaggccaaggacgccttcgacgtgctggtggtcggcggtggc
ccggctggcgccgcagcggccatctacgccgcgcgcaagggcatccgcaccggcgtagca
gccgagcgcttcggcggccaggtgctcgacaccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagaacacgtgcgtgaatacgac
gtcgacatcatgaacctgcagcgcgccagcaagctgattccggctggcgacgacggcctg
caccgcgtgcagttcgaaaacggcggcgagctcaaggccaagaccctgatcctcgccacc
ggcgcccgctggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgattggc
ggcggcaactccggcgtggaagcggccatcgacctggccggcattgtcgcccacgtgacc
ctgctcgagttcggcgaagagctgcgggccgacgccgtactgcagcgcaagctgttcagc
ctgcccaacgtccgcgtgctgaagatggcgcagaccaccgaggtcaagggcgacggccaa
aaggtcaccggtctggtctacaaggaccgcagcagcgaagacatgcacaccgtcgagctg
gaaggcatcttcgtgcagatcggcctgctgcccaacagcgaatggctcaagggcaccctg
gagctgtcgcgcttcggtgagatcatcgtcgatgccaagggccagaccagcatccccggc
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtgatcgctgtcggg
gaaggcgccaaagcctcgctgagcgctttcgaccacctgatccgcagctccgcaccggcc
tga

DBGET integrated database retrieval system