KEGG   Pseudomonas stutzeri 19SMN4: UIB01_01225Help
Entry
UIB01_01225       CDS       T03366                                 

Definition
(GenBank) ferredoxin
Organism
pstu  Pseudomonas stutzeri 19SMN4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_2 Fer4_9 Fer4_10 GF_recep_IV Fer4_4 Fer4_21 Fer4_6 Fer4_17 Fer4_8
Motif
Other DBs
NCBI-ProteinID: AHY41146
UniProt: A0A023WMF0
LinkDB All DBs
Position
complement(255225..255476)
Genome map
AA seq 83 aa AA seqDB search
MSLKITDDCINCDVCEPECPNSAISQGEEIYVIDPNLCTECVGHYDEPQCQQVCPVDCIP
LDENNVESKDELMQKYLIITGKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaaaatcaccgatgactgcatcaactgcgacgtgtgcgagccagagtgcccg
aacagcgccatttcccagggcgaggaaatctacgtcatcgaccccaacctctgcaccgaa
tgcgtcggccactacgacgagccacagtgccagcaggtctgcccggtggactgcatcccg
ctcgacgagaacaacgtcgagagcaaggacgaactgatgcagaagtacctgatcatcacc
ggcaaggcgtga

DBGET integrated database retrieval system