KEGG   Pseudomonas stutzeri 19SMN4: UIB01_02775Help
Entry
UIB01_02775       CDS       T03366                                 

Definition
(GenBank) hypothetical protein
Organism
pstu  Pseudomonas stutzeri 19SMN4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RepA_N
Motif
Other DBs
NCBI-ProteinID: AHY41439
UniProt: A0A023WNT1
LinkDB All DBs
Position
complement(605810..606388)
Genome map
AA seq 192 aa AA seqDB search
MARSRLKAKGRAEVGTFALLPHAVMDSEDFRSLSGSAHIVLMLLLRQYRGRNNGDLSAEF
SRAKQWGIGSKSTLAKALLELQARNLILRTREGRFMKPGGCCALYALTWQAIDECDGKIE
VAATATAPRKFSLERTKHPVQKVNGQGTKTVPIPSRTVPDNALMGIEIVPTARDGPVQKL
DSFLDLPGQSPH
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgcagccgacttaaagccaaaggccgcgcagaggtggggacctttgcgctgctg
ccccacgcagtgatggatagcgaagatttccgaagcctttccggcagcgcgcatatcgta
ctgatgctgctgctgcgtcagtaccgtggcaggaataatggagaccttagcgccgagttt
agccgcgccaaacagtggggaattgggagcaaaagcacccttgccaaagcgctgcttgag
ctacaagcgcgtaatttgattctgcggacacgtgagggccgatttatgaagcccggtggc
tgttgcgcgctgtacgcccttacctggcaagccatcgacgagtgcgacggcaaaattgaa
gtcgcggccaccgcaacagcacctcgcaagttcagcctggaaagaacaaaacacccggta
cagaaagtgaacgggcagggtacaaaaactgtaccgataccctcccgtaccgtacctgat
aatgcgctcatgggtatagaaatcgtaccgacggcgcgcgatggcccagtacaaaaactg
gactcctttttagatttaccagggcagagcccgcattag

DBGET integrated database retrieval system