KEGG   Pseudomonas stutzeri 19SMN4: UIB01_04540Help
Entry
UIB01_04540       CDS       T03366                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00970  Aminoacyl-tRNA biosynthesis
pstu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UIB01_04540 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pstu03029]
    UIB01_04540 (gatB)
Enzymes [BR:pstu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     UIB01_04540 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     UIB01_04540 (gatB)
Mitochondrial biogenesis [BR:pstu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UIB01_04540 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHY41774
UniProt: A0A023WPN8
LinkDB All DBs
Position
complement(979263..980708)
Genome map
AA seq 481 aa AA seqDB search
MQWETVIGLEIHAQLATQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMAC
KFGLAIDAEIAPKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGYLDITLEDGSTRRIGIT
RAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSVRPKGQTEFGTRAEIKNVNSFRFIEKAINHEVQRQIELIED
GGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASLPELPV
QKRERFEREFGLSAYDATVLAASREMADYFEQVNATCGDAKLAANWVMGELSSLLNKEGL
EIEQSPVAAEQLGGMILRIKDDTISGKIAKMVFEAMAAGEGSADEIIEKKGLKQVTDSGA
IEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKKKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaaaccgtgatcgggctggagattcacgcacagctcgcgacccagtcgaag
atcttttccggcagcgccaccaccttcggcgccgagcccaacacccaagccagcctggtc
gacctcggcatgcccggcaccctgccggtgctcaatgccgaagccgtgcgcatggcctgc
aagttcggcctagcgatcgatgccgagatcgcgccgaagaacgtcttcgcgcgcaagaac
tacttctaccccgacctgcccaagggctaccagaccagccagatggaccatcccatcgtc
ggcaagggctatctggacattaccctggaagacggcagcacgcggcgcatcggcatcacc
cgcgcgcatctggaagaggacgccggcaagagcctgcacgaagacttccacggcatgagc
ggcatcgacctcaaccgcgccggcacgccgctacttgaaatcgtctccgagccggacatc
cgttcggccaaggaagcggtcgcctacgtcaaggcgatccacgccctggtgcgctacctc
ggcatctgcgacggcaacatggccgaaggttcgctgcgctgcgactgcaacgtctcggta
cgacccaaggggcaaaccgagttcggcacccgcgccgagatcaagaacgtcaactcgttc
cgcttcatcgagaaagccatcaatcacgaagtacaacggcagatcgagctcatcgaggac
ggcggcaaggtggtgcaggaaacccgcctgtacgatccgaacaaggacgagacgcgctcc
atgcgcagcaaggaagaagccaacgactaccgttacttcccctgccccgatttgctgccg
gtggtgatcgagcagagcttcctcgacgaagtgcgcgccagcctgccggagcttccggtg
cagaagcgcgaacgcttcgagcgcgagttcggtctctccgcctatgacgccacggtgctg
gccgccagccgcgagatggccgactacttcgaacaggtcaatgccacctgcggcgacgcc
aagctggccgccaactgggtaatgggcgagctgtccagcctgctcaacaaggaaggcctg
gagatcgagcagtcgccggtagccgccgagcagctgggcggcatgatcctgcgcatcaag
gacgacaccatcagcggcaagatcgccaagatggtcttcgaagccatggccgctggtgaa
ggctcggctgacgagatcatcgagaagaaaggcctcaagcaggtcaccgactccggcgcg
atcgaggcgatgctcgacgaagtgctggcggccaatgccgagcaggtcgaacagtaccgt
gccagcgacgaagccaagcgcggcaagatgttcggcttcttcgtcggccaggcgatgaag
gcatccaagggcaaggcgaacccgggccaggtgaaccaactgctgaagaaaaagctcgaa
ggctaa

DBGET integrated database retrieval system