KEGG   Pseudomonas stutzeri 19SMN4: UIB01_08170Help
Entry
UIB01_08170       CDS       T03366                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UIB01_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHY42463
UniProt: A0A023WQP5
LinkDB All DBs
Position
complement(1710688..1711209)
Genome map
AA seq 173 aa AA seqDB search
MKQWIIAALAGCTALAAQAETLSVKVNTVSAQGIGESVGSVKIESSEYGLVFRPELTGLQ
PGAHGFHIHAKGSCEPAEIDGKQTPAGAAAGHWDPKNSGKHGEPWGDGHLGDLPALYVDS
EGKANQPVLAPRLKSLGDIKGLALMVHQGGDNHSDHPQPLGGGGARVACGVIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtggatcatcgccgcgctcgccggctgcacggccctcgccgctcaggccgaa
acgttgagcgtcaaggtcaacaccgtaagcgcccagggcatcggcgaatccgtcggcagc
gtgaagatcgaaagtagcgagtacggtctggtatttcgcccggaactcaccggcctgcag
ccaggcgctcacggattccacatccatgccaagggcagttgcgagccggctgagatagat
ggcaagcagaccccggccggcgccgccgccggacactgggacccgaagaacagcggcaag
catggcgagccttggggtgacgggcatctgggcgacctgcctgcgctgtatgtagacagc
gaaggcaaggccaaccaaccggtgctggccccgcgcctgaagagtctgggcgacatcaaa
ggcctggcgctgatggtccaccagggcggcgataaccactccgaccacccgcaaccactc
ggcggtggcggcgcaagggttgcctgtggcgtgatcgaataa

DBGET integrated database retrieval system