KEGG   Pseudomonas stutzeri 19SMN4: UIB01_09285
Entry
UIB01_09285       CDS       T03366                                 

Definition
(GenBank) 50S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pstu03009]
    UIB01_09285
Enzymes [BR:pstu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     UIB01_09285
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     UIB01_09285
Ribosome biogenesis [BR:pstu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    UIB01_09285
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_25 MTS Methyltransf_15 Methyltransf_24 Methyltransf_11
Other DBs
NCBI-ProteinID: AHY42670
UniProt: A0A023WSK7
LinkDB
Position
1942942..1945122
AA seq 726 aa
MTDRHELILTCPKGLEGLLLDEATALGLEEAREQTSAIRGFAALEVAYRLCLWSRLANRV
LLVISRFPTVDAETLYQGVHAVDWADHLQPAGSLAVEFSGRGSGIDNTHFGALKVKDAIV
DRLRTASGERPSIDKLDPDLRVHLRLDKGQAVLSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAILIRAGWPRIAAAGGALTDPMCGVGTFLVEGAMMAADIAPNLKRERWGFSAWLGHVP
ALWSRLHAEALARAEAGLAKPPLWIRGYEADPRLIQPGRNNIERAGLASWIKIYQGDVGD
FEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACLGWEAAVFTAAPDLGK
RMGIRSHKQYAFWNGALPCKLLLIKVELDQFVTGQRSTASEEHAQQQAPVEQARLSEGGQ
MFANRLQKNLRQLGKWARREGIECYRLYDADMPEYALAIDLYRDWVHVQEYAPPRSIDPE
KAQVRLLDALAAIPQALGIPREKVVVKRRERQTGTRQYERQASQGDFLEVAEGGVKLLVN
LTDYLDTGLFLDHRPLRLRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDLSKTY
LDWARRNLSLNGLSDRQRLEQGDVMAWLEEDRGEYDLIFIDPPTFSNSKRMEGVFDVQRD
HVALLDLAMARLAAGGALYFSNNFRKFVLDASVSERYAVEEITASTLDEDFRRNPRIHRA
WKLQAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgaccgatcgccatgaactgatccttacctgtcccaaaggactcgaaggcctgctgctc
gacgaagcaaccgcactcgggctagaggaagcgcgcgagcagacttccgcaattcgcgga
ttcgctgcgctggaagtagcctaccgactctgtctgtggtcacgtctggccaaccgcgta
ctgctagtgatcagccgttttcctactgtcgacgccgagacgctttatcaaggcgtacac
gctgtcgactgggcggatcacctgcagcctgccggaagcctggcggtggagttcagcggc
cgaggctcgggcatcgacaacactcacttcggcgcactcaaggtcaaggatgccatcgtg
gatcgtctgcgcaccgcatccggcgaacggccgagcatcgacaagctcgacccggatctg
cgtgtccatctgcgcctggacaaggggcaagcggtgctttcgctcgacctctccggacac
agcctgcaccagcggggctatcgcctgcagcagggcgcggcgccgctgaaggaaaacctc
gctgcggcgattctgatccgcgccggttggccgcgtattgctgctgccggtggtgcgttg
actgaccccatgtgcggtgttggtacctttctcgtcgaaggggcgatgatggcagcggac
atcgctccgaacctcaagcgcgaacgttgggggttcagcgcctggttgggacatgtgcct
gcgctttggtcccgtctgcatgctgaggccctggcgcgagcagaggccggcttggcaaaa
ccgccattgtggattcgcggctatgaggccgacccacggctgattcagccgggacgcaac
aacatcgagcgcgccggtctggccagttggatcaagatctatcagggcgacgtcggcgac
ttcgaaccgcgcccggaccagaatcagaagggcctggtcatctgtaatccgccttacggc
gagcgcctcggtgatgaggcgagtcttctctatctctatcaaaacctgggcgaacgcctg
cgtcaggcttgcctcggctgggaagcggctgtgttcactgccgcgccggatctcggcaag
cgcatgggcatccgcagccacaagcaatacgcgttctggaacggtgcgctgccgtgcaag
ctgctactgatcaaggtcgagctggatcagttcgtcaccggtcagcgcagcaccgctagc
gaggaacatgctcagcagcaggcgccagtggagcaagcacgcctcagcgaaggcgggcag
atgtttgccaatcgcctccagaagaacctgcgtcagctcggcaaatgggcgcgtcgcgaa
ggcatcgaatgctaccgcttgtatgatgccgacatgccggaatacgcgctggcgatcgac
ctgtatcgcgattgggtgcacgtgcaggaatatgctccgccacgctccatcgatccggaa
aaagctcaagtgcggctgctggatgccttggcggccattccacaagcgttgggaattccg
cgcgagaaggtcgtggtcaagcgccgcgagcgccagacaggaacacgtcagtacgagcgc
caggcctcccagggagatttcctcgaggtggccgaaggtggcgtcaagcttctggtcaac
ctgaccgattacctcgataccggactgtttctcgatcatcgccccctgcgcttgcggatc
cagcgcgaggcggccggcaagcgcttcctcaacctgttctgctataccgccaccgcaacc
gtgcacgcggcaaagggtggggcgcggagcactaccagcgtcgatttgtcgaagacctat
cttgactgggcgcgccgtaatctctcgctaaacgggctttcggaccggcagcggctggag
cagggggatgtgatggcctggctggaggaggatcgtggcgagtacgacctgatcttcatc
gacccgccgacgttctccaactccaagcgcatggaaggtgtattcgacgtgcagcgcgat
cacgtcgcattgctcgatctcgccatggcacggctagccgcaggcggcgcgctgtacttc
tccaacaactttcgcaagttcgtgctggatgcgagcgtgagcgaacgctatgccgtcgag
gaaatcaccgcctcgacgctggatgaggacttccggcgcaatccgcggatccaccgcgcc
tggaagctgcaggcgcgttga

DBGET integrated database retrieval system