KEGG   Pseudomonas stutzeri 19SMN4: UIB01_10275Help
Entry
UIB01_10275       CDS       T03366                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01130  Biosynthesis of antibiotics
pstu01230  Biosynthesis of amino acids
Module
pstu_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UIB01_10275
Enzymes [BR:pstu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     UIB01_10275
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     UIB01_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HNHc_6
Motif
Other DBs
NCBI-ProteinID: AHY42835
UniProt: A0A023WT09
LinkDB All DBs
Position
2164822..2165919
Genome map
AA seq 365 aa AA seqDB search
MSDADQLKALRVRIDSLDERILDLISERARCAQEVARVKTAALAEGESAVFYRPEREAWV
LKHIMELNRGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVI
STPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL
LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA
GDMAAQLYGLTKLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL
VPFHANRIDLTRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGQEAVALKVLGSY
PKAVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccgatcagctgaaggccctgcgggttcgaatcgacagccttgacgagcgc
attcttgacctgatcagtgagcgcgcccgctgcgcccaggaagtggctagggtcaagacc
gcggcgctggccgagggcgagtcggcggtgttctaccgaccagagcgcgaagcttgggtg
ctcaagcacatcatggagctcaatcgcgggccgctcgataacgaggagatggcgcgccta
ttccgcgagatcatgtcgtcctgcctggccctggagcagccgctccgggtcgcctatctc
ggcccggaaggtacgttctctcaggccgcggcgctcaagcatttcggccatgcggtgatc
agcacgccaatggcggccatcgacgaggtgtttcgtgaggttgtggcgggggccgtgaat
ttcggcgtagtgccggtggagaactccaccgaaggcgcggtcaatcacacgctggatagc
ttcctcgaacacgacatcgtgatctgcggcgaggtggagttgcgtatccatcatcatctg
ctggtgggtgagacgaccaagactgatcggatcacgcgcatctactcccatgcgcaatcg
ctggcgcagtgccgtaagtggcttgacgcccactacccgaatgtcgagcgcgtagcggtt
tccagcaatgcggatgcagccaagcgggtcaagagcgagtggaactctgcggccatcgcc
ggcgacatggcggcccagctctacggtctgaccaagctggccgagaagatcgaggatcgc
ccggataactccacgcggttcctgatcatcggtagccaggaagtcccgccgaccggcgac
gacaagacgtcgatcatcgtctcgatgcgtaacaagccgggtgcgctgcacgagttgctg
gtgccattccacgccaaccgcatcgatctcacccgcatcgagacgcggccgtcgcgcagc
ggaaaatggacctacgtgttcttcatcgacttcctcggtcatcatcaggatccgctgatc
aaggatgtcctggagaagatcggtcaggaagccgtggcgctgaaagtgttgggctcctat
cccaaagcagtcctttga

DBGET integrated database retrieval system