KEGG   Pseudomonas stutzeri 19SMN4: UIB01_11265Help
Entry
UIB01_11265       CDS       T03366                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    UIB01_11265 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pstu03400]
    UIB01_11265 (ligD)
Enzymes [BR:pstu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UIB01_11265 (ligD)
DNA repair and recombination proteins [BR:pstu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     UIB01_11265 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AHY43020
UniProt: A0A023WTK2
LinkDB All DBs
Position
2398146..2400710
Genome map
AA seq 854 aa AA seqDB search
MALDDYQRMRDFAATPEPSGKARRKTGKAQALQYCIQKHDATRLHYDFRLELEGTLKSWA
IPKGPSLDPGVRRLAVHVEDHPLEYATFEGTIPAGHYGAGDVIVWDRGVWIPQGDPQEGY
RKGKLKFSLEGEKLAGSWNLVRTHMDGKEEQWFLIKSRDEAAREEGEYDVVTAEPNSVLS
DRTLVPRKRGAAKARVAEVPAKPVKAPAKKRAPRRQSQAAKLEGAVPDEFPETFKPQLAT
LVDAVPSGDWRYEIKFDGYRMLARVDAGKVALFTRNGHDWTAKMPQQAAALAGLGLESGW
LDGEVVVPNEEGAPDFQALQNAFEAGRSGSILYYLFDVPYLNGMDLRDVPLEQRRAALRE
VLEGSDSELLRFSEDFTEQPDSILESACQMKLEGLIGKRAGSSYTSRRSSSWVKIKCSNR
QEFIIVGYTEPKGTRTGFGALLLGLHDDSGKLFYAGKVGTGFNQATLKSLHKQLKKLETD
KSPLATAAPAADVRGAQWLKPELMCEVAYAEMTRQGVVRHSVFHGLRSDKPADAITHERA
KPASRSSKAEQRQTDPIGSGRIKISSPERIIDPSSGITKIELARFYAQIAPWALPQLRAR
PLALVRAPEGITGELFFQKHADKLAIPHITQLDPALDPKHGALLVIDSAEALVGAAQMGT
IELHSWNAIAPELEHPDRFVLDLDPDPALPWKSMLEATQLTQTLLDEIGLASFLKTSGGK
GIHIVVPLDPVHGWSEVKAFSQAIAKYLAKLLPSHFSAVSGPKNRVGRIFIDYLRNSRGA
STVAPYSVRAREGLPVSVPIHREELADLKGANLWTVRNLLERLQELGDDDPWADMTRIRQ
TITAQMRERLGMPA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgatgactaccaacgcatgcgcgacttcgctgccacaccagagccgtctggc
aaggcgcggcgaaagacgggcaaagcccaggcgctgcagtattgcatccagaaacacgac
gccacgcggttgcattacgactttcgcctggagctggagggcacgctgaagagctgggcg
atccccaaaggcccgagcctggaccccggcgtgcgtaggctggcggtgcacgtggaagac
cacccgctggagtacgccacgttcgagggcaccataccggccgggcattacggcgcaggt
gatgtgatcgtctgggatcgcggcgtgtggataccgcagggtgatccgcaggagggttat
cgcaagggcaagctcaagttcagcctcgagggcgagaagctcgccggcagctggaacctg
gtgcgcacccacatggatggcaaggaggagcagtggttcctcatcaagtcccgtgacgag
gccgcgcgcgaggagggcgagtacgacgtcgtcaccgccgagccgaacagcgtgctcagc
gatcgcacgctggtcccacgcaaacgcggagcggccaaggctcgcgttgcggaagtgccg
gccaagccagtcaaggcgccggcaaaaaaacgcgcgccacgcaggcagagccaggcggca
aagctggaaggggccgttccggacgaatttccggaaacattcaagccgcagctggcgacg
ctggtggacgccgtgccgagcggcgactggcgctacgagatcaaattcgacggctaccgc
atgctcgcccgtgtcgacgccggcaaggtcgcgctgttcacccgcaacggccatgactgg
acggcgaagatgccacagcaggccgccgcgcttgccggcctggggcttgaatccggctgg
ctcgacggcgaagtggtggtgccgaacgaggagggcgctccggacttccaggcgttgcag
aatgcgttcgaagccggacgcagtgggagcattctttattacctgttcgacgtgccctat
ctgaacggcatggacctgcgcgatgtgccgctggaacagcgtcgcgcggcgttgcgtgaa
gtgctggaaggcagcgacagcgaattactgcgtttctccgaggatttcaccgagcagccg
gacagcattctggaaagtgcctgccagatgaagctcgaaggcctgatcggcaagcgagca
ggcagctcctatacctccaggcgcagcagcagctgggtcaagatcaagtgcagcaaccgg
caggaattcatcatcgtcggctacaccgagcccaagggcacgcgcaccgggttcggcgcc
ctgttgctggggctgcatgacgacagcggaaagctgttctatgcaggcaaggtcggcaca
ggcttcaatcaggccacgctgaaaagtctgcacaagcagttgaagaagctggaaaccgat
aaaagccctttggccacggcggcacctgctgccgatgtgcggggcgcgcaatggctcaaa
cccgaactgatgtgcgaggttgcctacgcggagatgacccgccaaggcgtggtccgccat
tcggtgttccatggcctgcgctcggacaagcccgccgacgccattacccatgagcgagcc
aagcccgccagtcgtagcagcaaagccgagcagcggcagacagaccccatcggcagcggg
cggatcaagatatccagtcccgagcggatcatcgatcccagcagcggcatcaccaagatc
gaactggcccgcttctacgcgcagatcgccccctgggccctgccgcagctgcgagcgcgc
ccgctggccctggtgcgcgccccggagggcatcaccggcgagctgttcttccagaagcac
gccgacaaactggccatcccgcacatcactcaactcgacccggcgctagacccgaagcac
ggtgcgttactggtgatcgacagcgccgaagcgctggtcggcgccgcgcagatgggcacc
atcgagttacatagctggaatgcgatagcgccagaactggagcacccggatcgcttcgtg
ctcgatctcgacccggacccggcgctgccctggaaaagcatgctcgaagccactcagttg
acccagacattgctggacgagatcggcctggcctcgttcctcaaaaccagcgggggcaaa
ggcatccacattgtcgtgccgctcgatcccgtacacggctggagcgaggtaaaggcgttc
agtcaggccatcgccaagtacctggccaagctgctgccgtcgcatttttcggcggtcagc
gggccgaagaaccgggtcggacgcatcttcatcgactacctgcgcaacagccgtggcgcc
agtacggtcgccccctattcggtgcgtgcccgcgagggtctgccggtttccgtgcccatc
caccgcgaagaactggcggacctcaagggtgccaatctctggaccgtacgcaacctgctg
gagcgtctgcaggagctgggcgacgacgatccctgggcggatatgacgcggatcaggcag
accatcaccgcacagatgcgcgagcgtcttggcatgccggcttaa

DBGET integrated database retrieval system