KEGG   Pseudomonas stutzeri 19SMN4: UIB01_19160Help
Entry
UIB01_19160       CDS       T03366                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00500  Starch and sucrose metabolism
pstu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UIB01_19160
Enzymes [BR:pstu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UIB01_19160
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     UIB01_19160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AHY44472
UniProt: A0A023WW81
LinkDB All DBs
Position
4041112..4042731
Genome map
AA seq 539 aa AA seqDB search
MRPLWYRNAAIYQIDPTLFRDSNGDGCGDLRGVTERLDYIRGLGCTAIWLMPFYQSPFED
AGYDISDHLQVDERFGDLADVVALLEKAEELGLHVIIELVVQHTSIQHKWFQEARRDRNS
PYRDYYIWADEPDDFMEPIFPTVEDSIWTWDDEAGQYYRHLFYKHEPDLDLTNPRVIHEI
ERIMSFWLRLGVSGFRIDAAVHMVRQAGGGELEKGYWLLEHMRDFVTMRRPETVLLGEID
TDPEKYVEYFGDEADRVTLLLDFWTNNHLFLALARQQAEPLVRALNSQPLPPSHSQYALW
IRNHDELSLDRLEEDERNEVMDTFAPDENMRAYDRGIRRRLAPMLDGDERRIAATHALLF
SLPGTPIIRYGEEIGMGDDLDRPERLAVRTPMQWSNEPNAGFSCSKGELAAPVIDEGPFT
YEKINVFAQTLRSDSLMARTGNMIRTRIGLREIGIGKRTTVEVDDPAVFAIRHDNGSTVL
MLVNLADQDTTVEITDDDLQDMVDVLADCDYDQPEGTPLKIRLGPYGYRWLRRKQQLFG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccactctggtaccgcaacgcggcgatctatcagatagacccaaccctgtttcgt
gacagcaacggcgacggctgcggcgatctgcgcggcgtcactgaacggctcgactacatt
cgcggcctgggctgcaccgccatctggctcatgcccttctaccagtcgcccttcgaggat
gccggctacgacatcagcgaccatctgcaggtggacgagcgcttcggtgatctggccgat
gtcgtcgccctgctggaaaaggccgaggaactgggtctgcacgtgatcatcgagctggtg
gtgcagcacacctccatccagcacaagtggtttcaggaggcgcgccgcgatcgcaactcg
ccctaccgcgactactacatctgggccgacgagcccgacgatttcatggagccgatcttt
ccgacggtcgaggacagcatctggacctgggacgacgaagccggccagtactatcgccac
ctgttctacaaacacgagccggacctggatctgaccaacccgcgggtcatccacgagatc
gagcgaatcatgtcgttctggctgcgcctgggcgtgtccggttttcgcatcgacgccgcg
gtgcacatggtgcgccaggccggcggtggtgaactggagaagggctactggctgctcgag
cacatgcgcgacttcgttaccatgcgccgccccgaaaccgtgctgctcggcgagatcgac
accgatccggagaagtacgtcgaatacttcggcgacgaggccgatcgtgtcaccctgcta
ctggatttctggaccaacaatcacctgttcctagccctggcacgccaacaggccgagccg
ctggtgcgcgcgctgaacagccaaccgctgccgcccagtcattcgcaatacgcgctgtgg
atccgcaaccacgacgagctgagcctcgaccgactggaagaggatgagcgcaacgaggtg
atggacaccttcgcccccgacgagaacatgcgcgcctacgatcgcggcattcgccgccgc
cttgcacccatgctcgacggcgacgagcgccgcatcgccgccactcacgccctgctcttc
tcgctacccggcacgccgatcattcgctatggcgaggaaatcggcatgggcgacgacctc
gaccgccctgaacgactcgccgtgcgcacgccgatgcagtggtccaacgagcccaacgcc
ggcttctcctgcagcaaaggggagctggccgcaccggtgatcgacgaagggcccttcacc
tacgaaaagatcaacgtgttcgcccagaccctgcgcagtgactcgctgatggcgcgcacc
ggcaacatgatccgcacacgcatcggcctgcgcgagattggcatcggcaagcgcacaacc
gtggaggtggacgatcccgccgtgttcgccatccgccacgacaacggctcgacggtactc
atgctggtcaacctggcagaccaggacaccaccgtggagatcactgacgacgacctgcag
gacatggtcgatgtgctcgccgactgtgactatgaccaaccggaaggtacgccgctgaag
attcgcctaggcccgtatggctaccgctggttgcggcgcaaacagcaattgttcggatga

DBGET integrated database retrieval system