KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22640
Entry
UIB01_22640       CDS       T03366                                 

Definition
(GenBank) dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    UIB01_22640
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     UIB01_22640
SSDB
Motif
Pfam: Aldedh OmdA
Other DBs
NCBI-ProteinID: AHY45197
UniProt: A0A023WY96
LinkDB
Position
pLIB119:55287..56738
AA seq 483 aa
MNTKLFINNVWVNSSDQQTFERKHPVSGEVMTECANSTVMDALKAAQAAQEAFQTWKTVG
PSERRRLLLRVAEVMESKTPEFIEVMAKEVGASALWAGFNVQMSANVFREAASLATQIQG
ETIPTDKSDTLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNAVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFAEKAKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGATVACGGMAQGAV
MPATILDHVKSNMRIYDEETFGPITVVIRCNGEAEAIRIANDSAYGLSSGVFGRDINRAL
RVGMSIEYGSVHINGSTVQSEAQAPYGGTKKTGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaatacaaaattgtttatcaacaatgtctgggtcaattccagtgaccaacagaccttc
gagcgaaagcaccccgtcagtggtgaggtgatgacggagtgtgcaaactccacggtgatg
gatgcgttaaaggccgcgcaagctgcccaagaggctttccagacctggaagactgttgga
ccttcggagcgtcgccgccttctgctgagggtcgctgaggttatggaaagtaaaacaccc
gagtttatcgaagtgatggccaaggaggtgggagcctccgctctttgggccggcttcaat
gtccagatgtcagccaatgtgttccgtgaagcggcatcgctggctacacaaattcagggg
gaaactattccgacagacaagtctgacacgctctcaatgacgctacgtcagccggtcggt
ccgatcctgagcatcgtgccgtggaacggcaccgcagtgctggcggcacgagccatcgct
tatccgctggtctgcggcaacgcggtggtattcaaaggttctgagtttagtcccgcgacg
catgccctgatcacccagtgcgtgcaggaagccgggctgcctgctggcgtgctcaactat
ctcaactcttcgcctgaccgttcgcccgagatcgccgacgcactgatctcagccaaggag
atccgacgcatcaacttcacgggctccacccgcgtgggcagtattatcgcgcagaaggcc
gcgcaacacctcaagcgctgcctgctggagctcggtggcaagtccccacttattgttctg
gatgacgcggacatcgacgcagctgtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccactgagcgcttggtggttgatgagaagatcgccgacgaattt
gtcgccaagtttgccgaaaaggccaagcgtttgagcgcgggcgacccatgcgtaactggc
gactgcatcatcggcccaatggtctcgccaaattcaggcgagcggatcaatggtttgttc
aaggacgcgatcgacaaaggagccacagttgcctgcggcggcatggcccaaggtgcggtc
atgccggccacgatcctggatcacgtcaaatccaacatgcggatctacgatgaggagacc
ttcggtcccatcactgtggtgatccgttgcaacggcgaagcagaggccattcgcattgcc
aacgacagcgcctatggcctgtcgtcgggcgtatttggccgcgacatcaaccgtgctttg
cgcgtgggcatgtccatcgaatatggttcagtgcacattaacggatcgactgtccaaagc
gaggcgcaggctccatacggagggactaagaaaaccggctacgggcgcttcgacggccgt
gctgtgatcgatgagttcacagagctcaagtggctgaccatcgagcctttcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system