KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22645
Entry
UIB01_22645       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    UIB01_22645
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     UIB01_22645
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: AHY45198
UniProt: A0A023WYN9
LinkDB
Position
pLIB119:56766..57674
AA seq 302 aa
MSKQTAVIELGYMGISVKDPDAWKSFATNMLGLQVFDEGEKDRFYLRMDYWHHRIVVHHN
GQDDLEYLGWRVSGKPEFEALGQKLIDAGYDVRVCDKAEAQERMVLGLMKTVDPGGNPTE
IFWGPRIDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVEAAHKFYSLLGLRGDVEYRI
PLPNGMTGELTFMHCNGRDHSIGFGAMPAEKRLNHVMLEYTDIEDLGYTHQQFVKNDIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGAKAIDEAEYYVGDIFGHGIETTGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagtaagcaaactgcagttattgaactcggatacatgggcatctcggtcaaggatcct
gatgcgtggaaatcattcgccacgaatatgctgggcctgcaagtttttgatgaaggtgag
aaggaccgtttctatctacgtatggattactggcatcatcgaatcgtggtccatcataac
ggccaggacgacctggaatacctgggctggcgtgtgtccggaaaaccggagttcgaggct
ctcggtcaaaaactcattgacgccggttacgatgttcgcgtctgcgataaagccgaggct
caggaacgaatggtgttgggcctgatgaagacagtagatccaggcggcaacccgaccgag
atattctgggggccgcggatcgacatgagcaacccgttccatcccggccgccccctgcac
ggcaagtttgtgactggtgaccaaggcctgggtcattgcatcgttcgccagaccgatgtc
gaagctgctcacaagttctatagtcttctgggattgcgtggggacgtcgaataccggatc
ccgctgcccaacggcatgactggcgaactaacgttcatgcattgcaatggtcgggaccac
tccattgggtttggtgccatgcccgctgaaaagaggctcaatcatgtgatgcttgagtac
accgacatagaggatctgggatacacccatcaacagtttgtaaagaacgacattgacatt
gccttgcaacttggcattcatgctaacgacaaggcgctgacgttctatggcgcaacacct
tccggctggctcattgagcccggctggcgaggtgccaaggccatagacgaagcggagtac
tacgttggagacatctttggccatggtatcgagaccactggctacggcttggatgtaaaa
ttgagttaa

DBGET integrated database retrieval system