KEGG   Pantoea stewartii subsp. stewartii: DSJ_01005Help
Entry
DSJ_01005         CDS       T04970                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
pstw  Pantoea stewartii subsp. stewartii
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pstw03110]
    DSJ_01005
Chaperones and folding catalysts [BR:pstw03110]
 Heat shock proteins
  HSP33
   DSJ_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ARF48099
UniProt: H3RHN6
LinkDB All DBs
Position
181238..182104
Genome map
AA seq 288 aa AA seqDB search
MSVNDQLRRYLFENAAVRGELVNVSNTWRETIKNHDYPPAVQTLLGELLVATSLLTATLK
FDGEITVQLQGDGPLTLAVINGNNQQELRGVARMKGEIPDDSTLKSMVGNGYLVITITPE
KGERYQGVVGLEGDTLSECLEDYFMRSEQLPTRLFIRTSDAGAAGILLQVLPAQDTDKED
FDHLATLTETIKTEELIDLPATDVLWRLYHQEEVTVYDPQPVIYKCTCSRERCGEVLKTL
PQEEVDEIIAEDGKIDMHCDYCGSHYVFDAVDIAGIRSNSVENSNRLH
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaacgatcaactgcgccgttatctgtttgaaaatgctgctgttcgcggcgaa
ctggtcaacgtttcaaacacctggcgtgaaaccattaaaaaccacgattatccacccgct
gtgcaaaccctgctgggtgagttactggtggcaaccagcctgcttaccgcgacgctgaaa
tttgatggtgagatcaccgtgcagttgcagggcgatggtccgctgacgctggccgtgatc
aatgggaataatcagcaggaattacgcggtgtcgcgcgaatgaaaggcgagatccctgac
gacagcacgcttaagagcatggtgggcaacggctatctggtgattacgattacgccagaa
aaaggtgagcgctatcagggcgtggtcggtctggaaggtgacacgctgagcgaatgcctg
gaagattacttcatgcgttcagaacagctgccaacccgactgtttatccgcaccagcgat
gcaggcgccgccgggattctgttacaggttctgcccgcgcaggacacggacaaagaggat
ttcgaccatctcgctacgttgacagagacgattaaaacagaagaattgatcgacctgccg
gcaactgatgtgctctggcgactgtaccatcaggaagaagtgaccgtttacgatccccag
ccggtgatctacaaatgtacctgctcgcgcgaacgttgcggcgaggtcctgaaaacgctg
ccgcaggaagaagtcgatgagattattgccgaagacggcaaaatcgatatgcattgcgac
tattgtggatcgcattatgttttcgatgctgtcgatattgccggtatccgcagcaactcc
gtggaaaacagcaaccgtcttcactga

DBGET integrated database retrieval system